| Basic Information | |
|---|---|
| Taxon OID | 3300021410 Open in IMG/M |
| Scaffold ID | Ga0213836_130748 Open in IMG/M |
| Source Dataset Name | Coastal seawater microbial communities from Marineland, Florida, United States - SWPA TP0 #3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 661 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Marineland, Florida, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Florida | |||||||
| Coordinates | Lat. (o) | 29.6703 | Long. (o) | -81.2145 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068991 | Metagenome | 124 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0213836_1307482 | F068991 | N/A | EGGMRFKGQPLTTDAIRTFLGTPTAQALAAASVDENLQFVRYLIDPRKAEGARLVFTLAAEGDPQLRRMELRNSVLVITPADAAAATHFELSREELAAFVLGTRPASEDALGQLDRVLDRSHMLPPGTIEALMQGMKGTGEFEH |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |