| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300021410 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0131207 | Gp0238774 | Ga0213836 |
| Sample Name | Coastal seawater microbial communities from Marineland, Florida, United States - SWPA TP0 #3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 142207656 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Coastal Seawater Microbial Communities From Marineland, Florida, United States |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Marineland, Florida, United States |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → coastal water body → coastal sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Florida | |||||||
| Coordinates | Lat. (o) | 29.6703 | Long. (o) | -81.2145 | Alt. (m) | N/A | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068991 | Metagenome | 124 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0213836_130748 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0213836_130748 | Ga0213836_1307482 | F068991 | EGGMRFKGQPLTTDAIRTFLGTPTAQALAAASVDENLQFVRYLIDPRKAEGARLVFTLAAEGDPQLRRMELRNSVLVITPADAAAATHFELSREELAAFVLGTRPASEDALGQLDRVLDRSHMLPPGTIEALMQGMKGTGEFEH |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |