Basic Information | |
---|---|
Taxon OID | 3300018570 Open in IMG/M |
Scaffold ID | Ga0193573_103322 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine microbial communities from upper halo cline of Thetis Basin, Eastern Mediterranean Sea - 18_4 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Woods Hole Oceanographic Institution |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 740 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Upper And Lower Halo Cline Of Thetis Basin, Eastern Mediterranean Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Eastern Mediterranean Sea | |||||||
Coordinates | Lat. (o) | 34.4 | Long. (o) | 22.08 | Alt. (m) | Depth (m) | 3259 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F037503 | Metagenome / Metatranscriptome | 168 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193573_1033221 | F037503 | N/A | MYLGTALRSSVIEVELLIGLGGFTAYQTLTNSECYNIYSRVRAWVLRSMSERERTQTIS |
⦗Top⦘ |