Sample 3300018570

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300018570

3300018570: Metatranscriptome of marine microbial communities from upper halo cline of Thetis Basin, Eastern Mediterranean Sea - 18_4

Overview

Basic Information
IMG/M Taxon OID	3300018570 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0129121 \| Gp0217193 \| Ga0193573
Sample Name	Metatranscriptome of marine microbial communities from upper halo cline of Thetis Basin, Eastern Mediterranean Sea - 18_4
Sequencing Status	Permanent Draft
Sequencing Center	Woods Hole Oceanographic Institution
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	20433191
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Metatranscriptome Of Marine Microbial Communities From Upper And Lower Halo Cline Of Thetis Basin, Eastern Mediterranean Sea
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Upper And Lower Halo Cline Of Thetis Basin, Eastern Mediterranean Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine benthic biome → marine benthic feature → hypersaline water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Eastern Mediterranean Sea
Coordinates	Lat. (^o)	34.4	Long. (^o)	22.08	Alt. (m)	N/A	Depth (m)	3259
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037503	Metagenome / Metatranscriptome	168	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0193573_103322	Not Available	740	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0193573_103322	Ga0193573_1033221	F037503	MYLGTALRSSVIEVELLIGLGGFTAYQTLTNSECYNIYSRVRAWVLRSMSERERTQTIS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.