NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300018570

3300018570: Metatranscriptome of marine microbial communities from upper halo cline of Thetis Basin, Eastern Mediterranean Sea - 18_4



Overview

Basic Information
IMG/M Taxon OID3300018570 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0129121 | Gp0217193 | Ga0193573
Sample NameMetatranscriptome of marine microbial communities from upper halo cline of Thetis Basin, Eastern Mediterranean Sea - 18_4
Sequencing StatusPermanent Draft
Sequencing CenterWoods Hole Oceanographic Institution
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size20433191
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetatranscriptome Of Marine Microbial Communities From Upper And Lower Halo Cline Of Thetis Basin, Eastern Mediterranean Sea
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Upper And Lower Halo Cline Of Thetis Basin, Eastern Mediterranean Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine benthic biomemarine benthic featurehypersaline water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationEastern Mediterranean Sea
CoordinatesLat. (o)34.4Long. (o)22.08Alt. (m)N/ADepth (m)3259
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037503Metagenome / Metatranscriptome168Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0193573_103322Not Available740Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0193573_103322Ga0193573_1033221F037503MYLGTALRSSVIEVELLIGLGGFTAYQTLTNSECYNIYSRVRAWVLRSMSERERTQTIS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.