| Basic Information | |
|---|---|
| Taxon OID | 3300018543 Open in IMG/M |
| Scaffold ID | Ga0188820_100491 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of freshwater lake microbial communities from Lake Tornetrask, Sweden - GS667_0p8 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 819 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Lake Tornetrask | |||||||
| Coordinates | Lat. (o) | 68.355835 | Long. (o) | 18.821667 | Alt. (m) | Depth (m) | .3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063493 | Metagenome / Metatranscriptome | 129 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0188820_1004912 | F063493 | N/A | MQTIFLIVLAVAIVGYLVMNREGLRWDRGFAGFRPAVTGVITEGNLEITGNPVEDVAIKALMIKKIVDATTEEIFRTKGLKMFPIETIFIQVFDSPDKIKELKQKRPDVYDAYVKFLQARDKDAVLTRNGDGTEQEQLARTALINYLEALKRDQDYNTVPDNVPATYRCRPIVSR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |