NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136993_10030799

Scaffold Ga0136993_10030799


Overview

Basic Information
Taxon OID3300010411 Open in IMG/M
Scaffold IDGa0136993_10030799 Open in IMG/M
Source Dataset NameAquatic microbial communities from North Sea petroleum storage tank - Cell3b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1231
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Aquatic → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location NameNorth Sea
CoordinatesLat. (o)60.9Long. (o)1.8Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033769Metagenome / Metatranscriptome176N

Sequences

Protein IDFamilyRBSSequence
Ga0136993_100307992F033769GAGMGIKTATLAASTVGIAANREYLRLTNESLVTRCRAGDSGITAEAGVIIEPGQTVEFRSLPSENKEIYVLSEGAAVELAYYEVILA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.