Basic Information | |
---|---|
Taxon OID | 3300010408 Open in IMG/M |
Scaffold ID | Ga0137020_103567 Open in IMG/M |
Source Dataset Name | Microbial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - End of the channel, sample P5-2012 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Illumina |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 711 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Microbial Communities From Soil Contaminated With Neutral Mine Drainage From Mine ??Rea In Canaa Dos Carajas, Brazil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canaa dos Carajas, PA, Brazil | |||||||
Coordinates | Lat. (o) | -6.42916667 | Long. (o) | -50.06611111 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068109 | Metagenome / Metatranscriptome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137020_1035672 | F068109 | AGG | MIEALHQAGFRNARACHFFDSFSGTTKEGVARKYGVQGANFIAHK* |
⦗Top⦘ |