NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010408

3300010408: Microbial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - End of the channel, sample P5-2012



Overview

Basic Information
IMG/M Taxon OID3300010408 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0121456 | Gp0155390 | Ga0137020
Sample NameMicrobial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - End of the channel, sample P5-2012
Sequencing StatusPermanent Draft
Sequencing CenterIllumina
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size15348415
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From Soil Contaminated With Neutral Mine Drainage From Mine ??Rea In Canaa Dos Carajas, Brazil
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Microbial Communities From Soil Contaminated With Neutral Mine Drainage From Mine ??Rea In Canaa Dos Carajas, Brazil

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → mine → contaminated soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationCanaa dos Carajas, PA, Brazil
CoordinatesLat. (o)-6.42916667Long. (o)-50.06611111Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018543Metagenome / Metatranscriptome234Y
F046057Metagenome / Metatranscriptome152Y
F061095Metagenome132Y
F068109Metagenome / Metatranscriptome125Y
F073995Metagenome / Metatranscriptome120Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0137020_100287Not Available1093Open in IMG/M
Ga0137020_100288All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1093Open in IMG/M
Ga0137020_102944Not Available741Open in IMG/M
Ga0137020_103567All Organisms → cellular organisms → Bacteria → Proteobacteria711Open in IMG/M
Ga0137020_113031All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria511Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0137020_100287Ga0137020_1002873F018543ANQSAAANRRPAGQLDGSDNLFATVAADRAFPAAVAELGR*
Ga0137020_100288Ga0137020_1002883F046057APPRPSTIVPGSAYPLLRLSALECLTSLADGVAYYAVC*
Ga0137020_102944Ga0137020_1029442F073995VINAARRIGIAFGSFVIAWLAVSLVARWLFGSGNILVWVIAAVVGAGVYLDILRRDRLDR
Ga0137020_103567Ga0137020_1035672F068109MIEALHQAGFRNARACHFFDSFSGTTKEGVARKYGVQGANFIAHK*
Ga0137020_113031Ga0137020_1130311F061095GDADGVANRVLGAMANSRIARFAAGEKVTVLVGSKAGEHASVEHVVWSERDRCHYFYLEQPGRKLSRGYRADELADGMGDTLG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.