Basic Information | |
---|---|
Taxon OID | 3300010230 Open in IMG/M |
Scaffold ID | Ga0136236_1009111 Open in IMG/M |
Source Dataset Name | Filterable freshwater microbial communities from Conwy River, North Wales, UK. Not filtered control. After WGA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Fidelity Systems Inc |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1118 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Filterable Freshwater Microbial Communities From Conwy River, North Wales, Uk |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Conwy River, Conwy, North Wales, UK | |||||||
Coordinates | Lat. (o) | 53.2 | Long. (o) | -3.82 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005200 | Metagenome | 408 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136236_10091111 | F005200 | GAGG | VDPITIFAACKAAHAGIRECIDLYQDFKKDGKDVGDIVGDIGKNLGAFFTHQESFKEAEKEAKKNPLPKNISINEEAMNRILRQQQLEQMETDLREMIIYQIGMPGLWSKFVEMREVVRKEREKVEREQKKPWSWLLSKDGNSLTNGKFVHRYLLAALSS* |
⦗Top⦘ |