NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120406_11431387

Scaffold Ga0120406_11431387


Overview

Basic Information
Taxon OID3300009429 Open in IMG/M
Scaffold IDGa0120406_11431387 Open in IMG/M
Source Dataset NameMicrobial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - FS844 no min length
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1065
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Diffuse Flow Fluid → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean

Source Dataset Sampling Location
Location NameMid-Cayman Rise
CoordinatesLat. (o)18.374735Long. (o)-81.797326Alt. (m)Depth (m)2376
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054534Metagenome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0120406_114313872F054534GGAMSEKEVTEKDYEEIVVKLAVSNDYLKKLEHLIDVKRIFSSRAEAFRRALELLFEKYKETLGESQTS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.