| Basic Information | |
|---|---|
| Taxon OID | 3300009429 Open in IMG/M |
| Scaffold ID | Ga0120406_11431387 Open in IMG/M |
| Source Dataset Name | Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - FS844 no min length |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1065 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Diffuse Flow Fluid → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mid-Cayman Rise | |||||||
| Coordinates | Lat. (o) | 18.374735 | Long. (o) | -81.797326 | Alt. (m) | Depth (m) | 2376 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054534 | Metagenome | 139 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120406_114313872 | F054534 | GGA | MSEKEVTEKDYEEIVVKLAVSNDYLKKLEHLIDVKRIFSSRAEAFRRALELLFEKYKETLGESQTS* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |