Basic Information | |
---|---|
Taxon OID | 3300003669 Open in IMG/M |
Scaffold ID | LSCM4E_1019157 Open in IMG/M |
Source Dataset Name | Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM4 Early Sample 3) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1189 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lithgow | |||||||
Coordinates | Lat. (o) | -33.460524 | Long. (o) | 150.168149 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F009639 | Metagenome / Metatranscriptome | 315 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LSCM4E_10191572 | F009639 | N/A | MRAWTVDADDIRVAEDFDAALLHRTPEIEEFLSHGGEKFVVIGTKGFGKTLLLKAKRVLTQRGG |
⦗Top⦘ |