Basic Information | |
---|---|
Taxon OID | 3300003471 Open in IMG/M |
Scaffold ID | FeGluNO3_10058658 Open in IMG/M |
Source Dataset Name | Fe-reducing enrichment culture from wetland. Sample 5 with periodic nitrate additions. |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3891 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From Dorn Creek, Dane County, Wisconsin, Usa, Enriched For Fe-Cycling Cultures |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Dorn Creek (Dane County, WI) | |||||||
Coordinates | Lat. (o) | 43.135131 | Long. (o) | -89.441777 | Alt. (m) | Depth (m) | 0 to .3048 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021332 | Metagenome | 219 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
FeGluNO3_100586583 | F021332 | AGGAG | MAKTPAAKTSRTSAKSRKPTLRVQVQHDIDQALAQAGIPSAIDSDGWRWMQDPSGKGLVGVVAVTGQREDLSLRVVAPIMPLPTGQAALLRALRRIAEMNYEIPGHSRLAIDSRTIWAVVTHDVGDIGPDDVPNCIFDCVWLAQAGAEWLKGPKPKKVTKKR* |
⦗Top⦘ |