| Basic Information | |
|---|---|
| Taxon OID | 3300003460 Open in IMG/M |
| Scaffold ID | DC01B_1213895 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S2-DC01B |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 530 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Douglas Channel, British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 53.6667 | Long. (o) | -129.1333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005815 | Metagenome / Metatranscriptome | 389 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| DC01B_12138952 | F005815 | AGGAG | MTMKVTRLTTYWTVDEAATVIDFLDMLRDVLWETYGEQITRMHREACDSRIQDINQCELGFDDDTPF* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |