| Basic Information | |
|---|---|
| Taxon OID | 3300003272 Open in IMG/M |
| Scaffold ID | Cyano_1000371 Open in IMG/M |
| Source Dataset Name | Black Band Cyanobacteria Enrichment |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 40743 |
| Total Scaffold Genes | 59 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 16 (27.12%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Cnidaria → Cnidaria Microbial Communities From The Caribbean, With Black Band Disease |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Looe Key Reef, Florida Keys National Marine Sanctuary, Florida, USA | |||||||
| Coordinates | Lat. (o) | 24.5484806 | Long. (o) | -81.4059137 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001506 | Metagenome / Metatranscriptome | 681 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Cyano_100037129 | F001506 | N/A | MKRVFYEVRCKCKEEISVTKKRKSSSRSEGKPFLYPNSNESMSQTFQIKYDGRLSGVAKYLLNSFHNKYLYYAIDDILYFLKSNKIEQENLLEILYSPVISLQNNLSINFFDIWIQEIYINDISKVNKFLNSKSHNLEAVSYITIKLLYRTKIPIKKQESLW* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |