| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003272 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110137 | Gp0103706 | Ga0057602 |
| Sample Name | Black Band Cyanobacteria Enrichment |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 117262816 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Cnidaria Microbial Communities From The Caribbean, With Black Band Disease |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Cnidaria → Cnidaria Microbial Communities From The Caribbean, With Black Band Disease |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Looe Key Reef, Florida Keys National Marine Sanctuary, Florida, USA | |||||||
| Coordinates | Lat. (o) | 24.5484806 | Long. (o) | -81.4059137 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001506 | Metagenome / Metatranscriptome | 681 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Cyano_1000371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 40743 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Cyano_1000371 | Cyano_100037129 | F001506 | MKRVFYEVRCKCKEEISVTKKRKSSSRSEGKPFLYPNSNESMSQTFQIKYDGRLSGVAKYLLNSFHNKYLYYAIDDILYFLKSNKIEQENLLEILYSPVISLQNNLSINFFDIWIQEIYINDISKVNKFLNSKSHNLEAVSYITIKLLYRTKIPIKKQESLW* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |