Basic Information | |
---|---|
IMG/M Taxon OID | 3300003272 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110137 | Gp0103706 | Ga0057602 |
Sample Name | Black Band Cyanobacteria Enrichment |
Sequencing Status | Permanent Draft |
Sequencing Center | |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 117262816 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Cnidaria Microbial Communities From The Caribbean, With Black Band Disease |
Type | Host-Associated |
Taxonomy | Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Cnidaria → Cnidaria Microbial Communities From The Caribbean, With Black Band Disease |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Looe Key Reef, Florida Keys National Marine Sanctuary, Florida, USA | |||||||
Coordinates | Lat. (o) | 24.5484806 | Long. (o) | -81.4059137 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001506 | Metagenome / Metatranscriptome | 681 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Cyano_1000371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 40743 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Cyano_1000371 | Cyano_100037129 | F001506 | MKRVFYEVRCKCKEEISVTKKRKSSSRSEGKPFLYPNSNESMSQTFQIKYDGRLSGVAKYLLNSFHNKYLYYAIDDILYFLKSNKIEQENLLEILYSPVISLQNNLSINFFDIWIQEIYINDISKVNKFLNSKSHNLEAVSYITIKLLYRTKIPIKKQESLW* |
⦗Top⦘ |