Basic Information | |
---|---|
Taxon OID | 3300003178 Open in IMG/M |
Scaffold ID | FcsdDRAFT_1000263 Open in IMG/M |
Source Dataset Name | 373C |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Max Planck Institute for Marine Microbiology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 29421 |
Total Scaffold Genes | 44 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 38 (86.36%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smoker Hydrothermal Chimney → Black Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Deep-Sea, Bismarck Sea, Papua New Guinea | |||||||
Coordinates | Lat. (o) | -3.721194 | Long. (o) | 151.674553 | Alt. (m) | Depth (m) | 1680 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030996 | Metagenome / Metatranscriptome | 183 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
FcsdDRAFT_100026315 | F030996 | AGGAG | MSSTNTLTGKLGKVTVDGSLVARITQWEVRPALANTNEWGDSDSAGYTNRSPGRKDCTFTTEGKFDTTNEVYDLFQPGDSAQVTLWINATLYWDFPSALCTEFSLLVNVDTEEVVGWTASWGADGQFYYPGETGAPVRTLP* |
⦗Top⦘ |