| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003178 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111369 | Gp0096880 | Ga0055412 |
| Sample Name | 373C |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Max Planck Institute for Marine Microbiology |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 96159472 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Black Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smoker Hydrothermal Chimney → Black Smoker Hydrothermal Chimney Microbial Communities From Manus Basin, Bismarck Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine black smoker biome → black smoker → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Deep-Sea, Bismarck Sea, Papua New Guinea | |||||||
| Coordinates | Lat. (o) | -3.721194 | Long. (o) | 151.674553 | Alt. (m) | N/A | Depth (m) | 1680 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030996 | Metagenome / Metatranscriptome | 183 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| FcsdDRAFT_1000263 | Not Available | 29421 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| FcsdDRAFT_1000263 | FcsdDRAFT_100026315 | F030996 | MSSTNTLTGKLGKVTVDGSLVARITQWEVRPALANTNEWGDSDSAGYTNRSPGRKDCTFTTEGKFDTTNEVYDLFQPGDSAQVTLWINATLYWDFPSALCTEFSLLVNVDTEEVVGWTASWGADGQFYYPGETGAPVRTLP* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |