Basic Information | |
---|---|
Taxon OID | 3300000493 Open in IMG/M |
Scaffold ID | MLSed_106020 Open in IMG/M |
Source Dataset Name | Lentic microbial communities from White Lake grasslands, BC, Canada |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Pennsylvania State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 620 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Microbial Communities From White Lake Grasslands, Bc, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | White Lake grasslands, BC, Canada | |||||||
Coordinates | Lat. (o) | 49.2833 | Long. (o) | -119.5833 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081499 | Metagenome / Metatranscriptome | 114 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
MLSed_1060201 | F081499 | N/A | VKAFSLENAYAVEKAQVVRNTEGSNESVVIGEMVDT |
⦗Top⦘ |