Basic Information | |
---|---|
Taxon OID | 3300000393 Open in IMG/M |
Scaffold ID | WOR_102559 Open in IMG/M |
Source Dataset Name | GB background transcript assembly |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Pennsylvania State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1267 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From Guaymas And Carmen Basins, Gulf Of California |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Guaymas Basin, Gulf of California | |||||||
Coordinates | Lat. (o) | 27.506 | Long. (o) | -111.347 | Alt. (m) | Depth (m) | 1990 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041592 | Metagenome / Metatranscriptome | 159 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
WOR_1025593 | F041592 | GAGG | MGRQERCPQCGSKKIVIADDLKKCKVCRYEWTGKPRGKTSKKDKVRF* |
⦗Top⦘ |