Basic Information | |
---|---|
Taxon OID | 3300000194 Open in IMG/M |
Scaffold ID | BBAY56_c10161328 Open in IMG/M |
Source Dataset Name | Delisea pulchra's surface microbial communities from Botany Bay, Sydney, Australia - BBAY56_SOAP_k25_Abyss_k41_GAA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 514 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra's Surface → Delisea Pulchra's Surface Microbial Communities From Botany Bay, Sydney, Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Botany Bay, Sydney, NSW, Australia | |||||||
Coordinates | Lat. (o) | -33.991017 | Long. (o) | 151.232433 | Alt. (m) | Depth (m) | 7 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F037503 | Metagenome / Metatranscriptome | 168 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BBAY56_101613282 | F037503 | N/A | VMEVELPIGLGGFTAYQPLMNSECHDTAAAVRQWVLRSIAERGTTQTIS* |
⦗Top⦘ |