x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300000194
3300000194: Delisea pulchra's surface microbial communities from Botany Bay, Sydney, Australia - BBAY56_SOAP_k25_Abyss_k41_GAA
Overview
| Basic Information |
| IMG/M Taxon OID | 3300000194 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0047590 | Gp0053858 | Ga0010862 |
| Sample Name | Delisea pulchra's surface microbial communities from Botany Bay, Sydney, Australia - BBAY56_SOAP_k25_Abyss_k41_GAA |
| Sequencing Status | Permanent Draft |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 485696515 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Delisea Pulchra's Surface Microbial Communities From Botany Bay, Sydney, Australia |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra's Surface → Delisea Pulchra's Surface Microbial Communities From Botany Bay, Sydney, Australia |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information |
| Location | Botany Bay, Sydney, NSW, Australia |
| Coordinates | Lat. (o) | -33.991017 | Long. (o) | 151.232433 | Alt. (m) | N/A | Depth (m) | 7 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F037503 | Metagenome / Metatranscriptome | 168 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| BBAY56_c10161328 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 514 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| BBAY56_c10161328 | BBAY56_101613282 | F037503 | VMEVELPIGLGGFTAYQPLMNSECHDTAAAVRQWVLRSIAERGTTQTIS* |
