x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300000194
3300000194: Delisea pulchra's surface microbial communities from Botany Bay, Sydney, Australia - BBAY56_SOAP_k25_Abyss_k41_GAA
Overview
Basic Information |
IMG/M Taxon OID | 3300000194 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047590 | Gp0053858 | Ga0010862 |
Sample Name | Delisea pulchra's surface microbial communities from Botany Bay, Sydney, Australia - BBAY56_SOAP_k25_Abyss_k41_GAA |
Sequencing Status | Permanent Draft |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 485696515 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | Delisea Pulchra's Surface Microbial Communities From Botany Bay, Sydney, Australia |
Type | Host-Associated |
Taxonomy | Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra's Surface → Delisea Pulchra's Surface Microbial Communities From Botany Bay, Sydney, Australia |
Alternative Ecosystem Assignments |
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
Location Information |
Location | Botany Bay, Sydney, NSW, Australia |
Coordinates | Lat. (o) | -33.991017 | Long. (o) | 151.232433 | Alt. (m) | N/A | Depth (m) | 7 |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F037503 | Metagenome / Metatranscriptome | 168 | Y |
Associated Scaffolds
Scaffold | Taxonomy | Length | IMG/M Link |
---|
BBAY56_c10161328 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 514 | Open in IMG/M |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
BBAY56_c10161328 | BBAY56_101613282 | F037503 | VMEVELPIGLGGFTAYQPLMNSECHDTAAAVRQWVLRSIAERGTTQTIS* |