NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068474

Metagenome / Metatranscriptome Family F068474

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068474
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 83 residues
Representative Sequence MIFFRVSTISTGSAAAFDGAFARCHGSRLFTFRLHFHHSPAVSFLTSPALGSFSRGLPSLRDLPGADALFVPPFGVFLLAVSTFYF
Number of Associated Samples 110
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 41.94 %
% of genes near scaffold ends (potentially truncated) 57.26 %
% of genes from short scaffolds (< 2000 bps) 98.39 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (82.258 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(33.065 % of family members)
Environment Ontology (ENVO) Unclassified
(35.484 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.742 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF10418DHODB_Fe-S_bind 0.81
PF01066CDP-OH_P_transf 0.81
PF00291PALP 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.81
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.81
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A82.26 %
All OrganismsrootAll Organisms17.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004117|Ga0058893_1011677Not Available589Open in IMG/M
3300004137|Ga0058883_1009519Not Available517Open in IMG/M
3300004137|Ga0058883_1024752Not Available526Open in IMG/M
3300004475|Ga0068969_1022603Not Available526Open in IMG/M
3300005640|Ga0075035_1121222All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium584Open in IMG/M
3300005841|Ga0068863_100176747Not Available2049Open in IMG/M
3300007526|Ga0075022_1057707Not Available502Open in IMG/M
3300009584|Ga0115597_1110922Not Available647Open in IMG/M
3300010112|Ga0127458_1128330Not Available558Open in IMG/M
3300010159|Ga0099796_10326114All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium656Open in IMG/M
3300010862|Ga0126348_1262921All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium558Open in IMG/M
3300010905|Ga0138112_1092739Not Available520Open in IMG/M
3300011058|Ga0138541_1069339Not Available641Open in IMG/M
3300011071|Ga0138595_1135502Not Available551Open in IMG/M
3300011084|Ga0138562_1049287Not Available554Open in IMG/M
3300011088|Ga0138576_1160922Not Available531Open in IMG/M
3300011120|Ga0150983_16018899Not Available571Open in IMG/M
3300011340|Ga0151652_13195018Not Available541Open in IMG/M
3300012372|Ga0134037_1091580Not Available677Open in IMG/M
3300012393|Ga0134052_1211910Not Available524Open in IMG/M
3300012778|Ga0138269_1189264Not Available531Open in IMG/M
3300014167|Ga0181528_10099987All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1578Open in IMG/M
3300014658|Ga0181519_10732427Not Available610Open in IMG/M
3300016678|Ga0180045_110662All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium772Open in IMG/M
3300016687|Ga0180047_1007758Not Available601Open in IMG/M
3300016698|Ga0181503_1000723Not Available668Open in IMG/M
3300016698|Ga0181503_1134785All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium613Open in IMG/M
3300016728|Ga0181500_1275618Not Available525Open in IMG/M
3300016730|Ga0181515_1236901Not Available568Open in IMG/M
3300019156|Ga0184576_109044Not Available652Open in IMG/M
3300019158|Ga0184580_116191Not Available643Open in IMG/M
3300019160|Ga0184577_119823Not Available553Open in IMG/M
3300019161|Ga0184602_115931Not Available657Open in IMG/M
3300019174|Ga0184579_104409Not Available552Open in IMG/M
3300019185|Ga0184587_118193All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium634Open in IMG/M
3300019185|Ga0184587_139973Not Available545Open in IMG/M
3300019190|Ga0184600_132446Not Available566Open in IMG/M
3300019207|Ga0180034_1144018Not Available611Open in IMG/M
3300019240|Ga0181510_1018088Not Available639Open in IMG/M
3300019240|Ga0181510_1110087Not Available548Open in IMG/M
3300019248|Ga0180117_1360181Not Available660Open in IMG/M
3300019256|Ga0181508_1150289All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium500Open in IMG/M
3300019256|Ga0181508_1434247Not Available681Open in IMG/M
3300019256|Ga0181508_1538235Not Available578Open in IMG/M
3300019258|Ga0181504_1176912All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium631Open in IMG/M
3300019260|Ga0181506_1021820All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium627Open in IMG/M
3300019268|Ga0181514_1468512Not Available627Open in IMG/M
3300019284|Ga0187797_1502953Not Available559Open in IMG/M
3300021855|Ga0213854_1103567Not Available565Open in IMG/M
3300021857|Ga0213849_1251733Not Available548Open in IMG/M
3300021909|Ga0213846_1054235Not Available513Open in IMG/M
3300021929|Ga0213845_1065435Not Available585Open in IMG/M
3300022154|Ga0213929_1029837Not Available549Open in IMG/M
3300022500|Ga0242643_111270Not Available653Open in IMG/M
3300022504|Ga0242642_1091990Not Available522Open in IMG/M
3300022504|Ga0242642_1097326All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium511Open in IMG/M
3300022507|Ga0222729_1019521Not Available792Open in IMG/M
3300022510|Ga0242652_1028160Not Available635Open in IMG/M
3300022523|Ga0242663_1091659Not Available595Open in IMG/M
3300022525|Ga0242656_1135353Not Available510Open in IMG/M
3300022527|Ga0242664_1069787Not Available676Open in IMG/M
3300022533|Ga0242662_10215554Not Available610Open in IMG/M
3300022533|Ga0242662_10351104Not Available503Open in IMG/M
3300022711|Ga0242674_1038895Not Available622Open in IMG/M
3300022714|Ga0242671_1075315Not Available604Open in IMG/M
3300022716|Ga0242673_1127176Not Available517Open in IMG/M
3300022718|Ga0242675_1039955Not Available750Open in IMG/M
3300022718|Ga0242675_1123155All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium521Open in IMG/M
3300022720|Ga0242672_1102439Not Available563Open in IMG/M
3300022722|Ga0242657_1246587Not Available511Open in IMG/M
3300022726|Ga0242654_10188895Not Available710Open in IMG/M
3300022726|Ga0242654_10298152Not Available592Open in IMG/M
3300023541|Ga0247544_101189Not Available648Open in IMG/M
3300023561|Ga0247518_115252Not Available694Open in IMG/M
3300023662|Ga0247545_101585Not Available802Open in IMG/M
3300023684|Ga0247523_116596Not Available546Open in IMG/M
3300023689|Ga0247517_113473Not Available725Open in IMG/M
3300025862|Ga0209483_1154190Not Available952Open in IMG/M
3300029701|Ga0222748_1068314Not Available642Open in IMG/M
3300030055|Ga0302173_10330184Not Available583Open in IMG/M
3300030503|Ga0311370_12050959Not Available569Open in IMG/M
3300030536|Ga0210266_1090339Not Available552Open in IMG/M
3300030545|Ga0210271_10207966Not Available755Open in IMG/M
3300030573|Ga0210272_1251695Not Available548Open in IMG/M
3300030588|Ga0210283_1453585Not Available504Open in IMG/M
3300030589|Ga0210255_10184164Not Available562Open in IMG/M
3300030595|Ga0210276_10171940Not Available555Open in IMG/M
3300030730|Ga0307482_1153030All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium674Open in IMG/M
3300030730|Ga0307482_1168884Not Available648Open in IMG/M
3300030730|Ga0307482_1261153Not Available546Open in IMG/M
3300030763|Ga0265763_1028077Not Available626Open in IMG/M
3300030776|Ga0075396_1039818All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium609Open in IMG/M
3300030805|Ga0265756_115038Not Available534Open in IMG/M
3300030815|Ga0265746_1065647Not Available525Open in IMG/M
3300030824|Ga0265726_102999Not Available663Open in IMG/M
3300030841|Ga0075384_10107453All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium780Open in IMG/M
3300030845|Ga0075397_10036284All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium620Open in IMG/M
3300030849|Ga0075393_10042931Not Available548Open in IMG/M
3300030850|Ga0075387_11787218All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium517Open in IMG/M
3300030852|Ga0075389_10010064Not Available537Open in IMG/M
3300030853|Ga0075372_10067196Not Available616Open in IMG/M
3300030854|Ga0075385_10037370Not Available546Open in IMG/M
3300030855|Ga0075374_10029626Not Available578Open in IMG/M
3300030862|Ga0265753_1128361Not Available536Open in IMG/M
3300030885|Ga0265743_112470Not Available603Open in IMG/M
3300030886|Ga0265772_107383Not Available516Open in IMG/M
3300030946|Ga0075379_10041585All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium684Open in IMG/M
3300030947|Ga0075390_10062640Not Available539Open in IMG/M
3300030950|Ga0074034_10071691Not Available532Open in IMG/M
3300030950|Ga0074034_11290500Not Available523Open in IMG/M
3300030963|Ga0265768_110212Not Available601Open in IMG/M
3300030970|Ga0075381_11574640All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium543Open in IMG/M
3300030977|Ga0265721_1013159Not Available553Open in IMG/M
3300031015|Ga0138298_1532042Not Available531Open in IMG/M
3300031057|Ga0170834_103269962Not Available790Open in IMG/M
3300031236|Ga0302324_103025043Not Available558Open in IMG/M
3300031446|Ga0170820_10242851All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium647Open in IMG/M
3300031469|Ga0170819_18029471All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium545Open in IMG/M
3300031632|Ga0310102_107539Not Available579Open in IMG/M
3300031664|Ga0310118_120608Not Available536Open in IMG/M
3300031813|Ga0316217_10003345All Organisms → cellular organisms → Bacteria18349Open in IMG/M
3300031871|Ga0316036_105190Not Available806Open in IMG/M
3300031871|Ga0316036_115874Not Available541Open in IMG/M
3300031956|Ga0316032_106351Not Available584Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil33.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.77%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.68%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds4.03%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.03%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.23%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.23%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.42%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.61%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.61%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.61%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.81%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.81%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.81%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland0.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.81%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.81%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.81%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.81%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.81%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004117Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF222 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004137Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004475Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005640Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300007526Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2012 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009584Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010112Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010862Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010905Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011058Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011071Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011084Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011088Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300012372Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012393Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012778Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300016678Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES102 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016687Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES104 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016698Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016728Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016730Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019156Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019158Soil microbial communities from Bohemian Forest, Czech Republic ? CSI1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019160Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019161Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019174Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019185Soil microbial communities from Bohemian Forest, Czech Republic ? CSE2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019190Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019207Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019240Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019248Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019258Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019260Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021855Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021857Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021909Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - NH:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021929Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - DR:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022154Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022500Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022504Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022510Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022525Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022527Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022711Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023541Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023561Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023662Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023684Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023689Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030055Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030536Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030573Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030588Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE011SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030589Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030763Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030776Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030805Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030824Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030841Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030845Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030849Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030850Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030852Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030853Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030854Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030855Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030885Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030886Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030946Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030947Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030950Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030963Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030970Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030977Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031015Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031632Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031664Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300031871Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE2 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031956Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0058893_101167713300004117Forest SoilMIFFRVSTISTGSAAAFDGAFARCHGSRLFTFRLHFHHSPAVSFLTSPALGSFSRGLPSLRDLPGADALFVPAFAVFLLAVSTFYI*
Ga0058883_100951913300004137Forest SoilSATAFDGAFARRHGSRLFTLKLLLFHSPAVSFLTSPTPGSFSRGLPSLRGLPDPDSRFVPPFGVFLLADSTFYF*
Ga0058883_102475223300004137Forest SoilDTPMIFFRVSTISTGSAAAFDGAFARCHGSRLFTFRLHFHHSPAVSFLTSPALGSFSRGLPSLRDLPGADALFVPAFAVFLLAVSTFYI*
Ga0068969_102260313300004475Peatlands SoilFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTLGSFSRGLPSLRDLPGPDSRFVPPFGVFLLADPTFYF*
Ga0075035_112122223300005640Permafrost SoilMIFFRVSTISTGSAAAFDGAFARCHGSRLFTFRLHFHHSPAVSFLTSPALGSFSRGLPSLHDLPGADALFVPAFAVFLLAVSTFYF*
Ga0068863_10017674723300005841Switchgrass RhizosphereMILFRVSTISTGSAAVFDSAFAPCHGSRLFTLRLLFIHSPAVSFLTSPVLGSFSRGLPSLRVLPGANALFVPPFGVFLLAVPTFYF*
Ga0075022_105770713300007526WatershedsSTGSAAAFDGAFARCHGSRLFTFRLPFHHSPAVSFLTSPALGSFSRGLPSLRDLPGADALFVPAFAVFRLAVSTFYF*
Ga0115597_111092213300009584WetlandMNLLRVSTICTGTAAAFDSAFARCHGSRLFTLRLLFNHSPAVSFLTSPMLGSFSRGLPSLRGLPGANALFVAPFGVFRLAVSTFYF*
Ga0127458_112833023300010112Grasslands SoilFRVSTISTGSAAVFDSAFAPCHGSRLFTLRLLFDHSPAVSFLTSPTLGRFSRGLPSLRVLPGANTLFVPPFGVFLSAVSTFYF*
Ga0099796_1032611413300010159Vadose Zone SoilMIFFRVSAIGTGSAAVFDSAFAPCHGSRLFTLRLHFHHSPAVSFLTSPALGSFSRGLPSLRGLPGANALFVAPFGVFLLAVPTFYF*
Ga0126348_126292113300010862Boreal Forest SoilSATVFDGAFARGHGSRLFTLKLLFIHSPAVSFLTSPALGSFSRGLPSLRGLPGSNAPFVPPFGVFLLAVPTFLFLNPPESSVRADTQ*
Ga0138112_109273913300010905Grasslands SoilGSATAFGGAFARRHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPGPDSRFVPPFGVFLLADPTFYF*
Ga0138541_106933913300011058Peatlands SoilASTGGCATGLRTRLRHACNFFRVSTISTGSAAVFDSAFARRNGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRDLPSLRGLPGPDSRFVPPFGVFLSAGPTFYF*
Ga0138595_113550223300011071Peatlands SoilSAAAFDGAFARRHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRDLPSLRGLPGPDSRFVPPFGVFLSAGPTFYF*
Ga0138562_104928713300011084Peatlands SoilGSAAVFDSAFARRHGSRLFTLRLLFIHSPAVSFLTSPALGSFSRGLPSLRDLPGSDAHFVPPFGVFHLAVPTF*
Ga0138576_116092213300011088Peatlands SoilVSTISTGSAAAFDGAFARCHGSRLFTLRLLFSHSPAVSFLTSPMLGSFSRGLPSRRVLPGTNANFVPPFGVFQLANLRFYFVTARVLRPC*
Ga0150983_1601889923300011120Forest SoilMIFFRVSTISTGSAAVFDSAFAPCHGSRLFTLKLLFNHSPAVSFLTSPMLGSFSRGLPSLRVLLGANALFVAPFGVFLLVVPTFYF*
Ga0151652_1319501813300011340WetlandMIFFRVSTISTGSAADFVSAFAPCHGSRLSTLRLLFIHSPAVSFLTSPVLGRFSRGLPSLRVLPGANALFVPPFDVFLLADLRFDT*
Ga0134037_109158013300012372Grasslands SoilMILFRVSTISTGSAAVFNSAFAPCHGSRLFTLKLLFIHSPAVLFLTSPVLGSFSRGLPSRRVLPGANALFVPPFGVFLLAVSTFLFLNPPEPSVRADAQ*
Ga0134052_121191013300012393Grasslands SoilMILFRVSTISTGSAAVFNSAFAPCHGSRLFTLKLLFIHSPAVLFLTSPVLGSFSRGLPSRRVLPGANALFVPPFGVFLLAVSTFYF*
Ga0138269_118926413300012778Freshwater LakeFDSAFALCHGSRLFTLRLHFSHSPAVSFLTSPTLGSFSRGLPSLRDLPGSDTHFVAPFSVFHLAVSTFYF*
Ga0181528_1009998713300014167BogVSTISTRSAAAFDGAFARCHGSRLFTLRLLFHHSPAVLFLTSPALGSFSRGLPSLRDLPGADALFVPAFAVFLLAVSTFYF*
Ga0181519_1073242713300014658BogMIFFRVSTISTGSAAAFDGAFARRHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPDPDSRFVPPFGV
Ga0180045_11066223300016678FreshwaterMIFFRVSTISTGSAAAFDGAFARCHGSRLFTLRLLFHHSPAVSFLTSPALGSFSRGLPSLRDLPGANALFVPPFSVFLLAVPTFYF
Ga0180047_100775813300016687FreshwaterMIFFRVSTISTGSAAAFDGAFARCHGSRLFTFRLLFHHSPAVLFLTSPALGSFSRGLPSLRDLPGANALFVPLFSVFLLAVSTFYF
Ga0181503_100072313300016698PeatlandMIFFRVSTISTRSAAAFDGAFARCHGSRLFTFRLPFHHSPAVSFLTSPALGSFSRGLPSLRDLPGADALFVPAFAVFLLAVSTFYF
Ga0181503_113478523300016698PeatlandMILFRVSTISTRSAAAFDGAFARCHGSRLFTLRLLFHHSPAVSFLTSPALGSFSRGLPSLRDLPGANALFVPPFSVFLLAVSTFYF
Ga0181500_127561823300016728PeatlandSTGSAAVFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPGPDSRFVPPFGVFLLADPTFYFWIPPESSVRADAQ
Ga0181515_123690113300016730PeatlandMIFFRVSTISTRSAAAFDGAFARCHGSRLFTLRLLFHHSPAVSFLTSPTLGSFSRGLPSLRDLPGADALFVPAFAVFLLAVSTFYF
Ga0184576_10904413300019156SoilMIFFRVSTISTGSAAAFDSAFAQCHGSRLFTLRLLFHHSPAVSFLTSPMLGSFSRGLPSLRDLPGADALFVPAFAVFLLPVSTFYF
Ga0184580_11619123300019158SoilMIFFRVSTISTGSAAAFDSAFAQCHGSRLFTLRLPFHHSPAVSFLTSPTLGSFSRGLPSLRDLPGADALFVPAFAVFLLPVSTFYF
Ga0184577_11982313300019160SoilTGSAAVFDSAFARCHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPGPDSRFVPPFGVFLLADSTFYF
Ga0184602_11593123300019161SoilMIFFRVSTISTGSAAAFDSAFAQCHGSRLFTLRLPFHHSPAVSFLTSPTLGSFSRGLPSLRDLPGADALFVPAFAVFLSAVSIFYF
Ga0184579_10440913300019174SoilRVSTISTGSAAAFDGAFARRHGSRLFTLKLPFFHSPAVSFLTSPMLGSFSRGLPSHRVLPGVDAHFVPPFGVFLLVGPVFA
Ga0184587_11819323300019185SoilMIFFRVSTISTGSAAAFDSAFARCHGSRLFSFRLPFHHSPAVSFLTSPALGSFSRGLPSLHDLPGSDALFVPPFGVFLLAVTTFYF
Ga0184587_13997323300019185SoilAAFDGAFARCHGSRLFTLKLLFFHSPAVSFLTSPTLGSLSRGLPSLRGLPGANARFVPPFGVFLLANSTFYF
Ga0184600_13244623300019190SoilSTISTGSAAAFDSAFAQCHGSRLFTLRLLFHHSPAVSFLTSPMLGSFSRGLPSLRDLPGADALFVPAFAVFLLPVSTFYF
Ga0180034_114401813300019207EstuarineMNLLRVSTIYTGTAAAFDSAFARCHGSRLFTLRLLFNHSPAVSFLTSPMLGSFSRGLPSLRGLPGANALFVPPFGVFRLAVSTFYF
Ga0181510_101808823300019240PeatlandMIFFRVSTISTGSAAAFDGAFARCHGSRLFTFRLLFHHSPAVSFLTSPALGSFSRGLPSRRDLPGADALFVPAFAVFRLAVSTFYF
Ga0181510_111008713300019240PeatlandPMIFFRVSTISTRSAAAFDGAFARCHGSRLFTFRLPFHHSPAVSFLTSPALGSFSRGLPSLRDLPGADALFVPAFAVFLLAVSTFYF
Ga0180117_136018113300019248Groundwater SedimentMIFFRVSTIISTGSAAAFDSAFAPCHGSRLFTLRLLFHHSPAVSFLTSPTLGSFSRGLPSLRVLPGANALFVPPFGVFLSADLRFDA
Ga0181508_115028913300019256PeatlandRVSTISTRSAAAFDGAFARCHGSRLFTLRLLFHHSPAVSFLTSPALGSFSRGLPSLRDLPGANALFVPPFSVFLLAVSTFYF
Ga0181508_143424713300019256PeatlandMTFFRVSTISTGSAAVFDSAFARRHGSRLFTLKLLFIHSPAVSFLTSPTLGSFSRGLPSLRGLPGSDAHFVPPFSVFHLAVPTF
Ga0181508_153823513300019256PeatlandLFRVSTISTGSAAVFDGAFARCHGSRLFTFRLPFHHSPAVSFLTSPALGSFSRGLPSLRDLPGADALFVPAFAVFRLAVSTFYF
Ga0181504_117691213300019258PeatlandMIFFRVSAISTKSAAAFNGAFARCHGSRLFTFRLHFHHSPAVSFLTSPALGSFSRGLPSLHDLPGADALFVPVFAVFLLAVSTFYFKPARVVRPC
Ga0181506_102182013300019260PeatlandMIFFRVSTISTGSAAAFDGAFAQCHGSRLFTLRLLFHHSPAVSFLTSPALGSFSRGLPSLRDLPGANALFVPPFSVFLLAVSTFYF
Ga0181514_146851213300019268PeatlandMILFRVSTISTGSAAVFDGAFARCHGSRLFTFRLPFHHSPAVSFLTSPALGSFSRGLPSLRDLPGADALFVPAFAVFRLAVSTFYF
Ga0187797_150295323300019284PeatlandGSGSAAAFGGAFARCHGSRLCSLKLPLIHSPAVSFLTSPALGSFSRGLPSLRGLPGSDSPFVLPFGIFRLAASTIV
Ga0213854_110356723300021855WatershedsSTISTGSAAVFDSAFAPCHGSRLFTLRLLFHHSPAVSFLTSPTLGSFSRGLPSLRVLPGANALFVPAFAVFLLAVLTFYF
Ga0213849_125173323300021857WatershedsAPGQPLCFHSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTLGSFSRGLPSLRGLPGANARFVPPFGVFLLAGSTFYY
Ga0213846_105423513300021909WatershedsAAFGSAFARNHGSRLFTLKLHFIHSPAVSFLTSPALGSFSRGLPGLRVLPGSYALFVPPFGVFLLAVPTFLFLNPPESSDRADTQ
Ga0213845_106543513300021929WatershedsFIRVSTISTGSAAAFDGAFARCHGSRLFTLRLLFHHSPAVSFLTSPALGSFSRGLPSRRVLPGADALFVPLFGVFLLAAPTFYF
Ga0213929_102983713300022154FreshwaterSATAFDGAFAQNHGSRLFTLKLLFIHSPAVSFLTSPALGSFSRGLPSLRGLPGSNAPFVAPFSVFLLAVPTFLFLNPPESSVRADTQ
Ga0242643_11127013300022500SoilMIFFRVSTISTGSAAAFDSAFARCHGSRLFTFRLLFHHSPAVLFLTSPALGSFSRGLPSLRDLPGADALFVPAFAVFLLAVSTFYF
Ga0242642_109199013300022504SoilMIFFRVSTISTGSAAAFDSAFARCHGSRLFTFRLLFHHSPAVLFLTSPALGSFSRGLPSLRDLPGANALFVPPFGVFLLAVSTFYF
Ga0242642_109732613300022504SoilMIFFRVSTISTGSAAVFDSAFAPCHGSRLFTLRLHFHHSPAVSFLTSPALGSFSRGLPSLRDLPGVDALFVPAFAVFLLAVSTFYI
Ga0222729_101952123300022507SoilMIFFRVSTISTGSAAAFDGAFARCHGSRLFTFRLHFHHSPAVSFLTSPALGSFSRGLPSLRDLPGADALFVPPFGVFLLAVSTFYF
Ga0242652_102816023300022510SoilMIFFRVSTISTGSAAAFDSAFAPCHGSRLFTLKLLFNHSLAVSFLTSPTLGSFSRGLPSLRGLPGADAHFVVPFGVFHLAVPTFYF
Ga0242663_109165923300022523SoilMIFFRVSTISTGSAAAFDGAFARCHGSRLFNFRLLFHHSPAVSFLTSPALGSFSRGLPSLRVLPGTDSFFVPPFGVFFCGRNFFNFAAARVFRPC
Ga0242656_113535313300022525SoilPLASGLPPSFDGAFARGYGSRLFTLKLLFIHSPAVSFLTSPALGSFSRGLPGRRGLPGVDSHFVPPFSVFLLADRIF
Ga0242664_106978713300022527SoilMIFFRVSTISTGSAAVFDSAFARRDGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPGPDSRFVPPFGVFLLADSTFYF
Ga0242662_1021555413300022533SoilMIFFRVSTISTGSAAAFDSAFARCHGSRLFTFRLLFHHSPAVLFLTSPALGSFSRGLPSLRDLPGADALFVPPFGVFLLAVSTFYF
Ga0242662_1035110413300022533SoilVSTISTGSAAVFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTLGSFSRGLPSLRGLPGPDSRFVPPFGVFLLADSTFYF
Ga0242674_103889513300022711SoilAVFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPDPDSRFLPPFGVFLLADSTFYF
Ga0242671_107531513300022714SoilSRHACDCFFRVLTIGSGSAAAFGSAFARCHGSRLFTLKLLFNHSPAVSFLTSPMLGSFSRGLPSLRVLLGANALFVAPFGVFLLVVPTFYF
Ga0242673_112717613300022716SoilGSATAFGGAFARSHGSRLFSLKLPFFHSPAVPFLASPALEAFSRGLPGLRVLPGADSFFVPPFGVFFGRLQLF
Ga0242675_103995513300022718SoilAAAFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPGPDSRFVPPFGFFLLADPTFYF
Ga0242675_112315523300022718SoilSAAVFDSAFAPCHGSRLFTLRLLFIHSPAVSFLTSPALGSFSRGLPSLRGLPGANALFVPPFGVFLLAVPTFYF
Ga0242672_110243913300022720SoilTISTGSAAAFDGAFARCHGSRLFTFRLLFHHSPAVSFLTSPALGSFSRGLPSLRGLPGANAHFVPPFSVFRLADLRFFA
Ga0242657_124658713300022722SoilMILFRVLTISIGSAAAFNGALAPCHGSRLFTLRLPFTHSPAVSFLTSPALGSFSRGLPSLRGLPGADAHFVAPFGVFHLAVPTFHFWTRQSRPSVLM
Ga0242654_1018889523300022726SoilMIFFRVSTISTGSAAAFNGAFARCHGSRLFTFRLHFHHSPAVSFLTSPALGSFSRGLPSLRDLPGADALFVPPFGVFLLAVSTFYF
Ga0242654_1029815213300022726SoilIFFRVLTISIGSAASFNGALAPCHGSRLFTLRLPFTHSPAVSFLTSPALGSFSRGLPSLRALPGADALFVLPFGVFLLAVPTFYF
Ga0247544_10118923300023541SoilMIFFRVSTTSTGSAAAFDSAFAQCHGSRLFTLRLPFHHSPAVSFLTSPTLGSFSRGLPSLRDLPGADALFVPAFAVFLLPVSTFYF
Ga0247518_11525223300023561SoilMIFFRVSTISTGSAAVFDSAFARRHGSRLFTLQLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPGPDSRFVPPFGVFLLAGSTFYF
Ga0247545_10158513300023662SoilMIFFRVSTISTGSAAAFDSAFAQCHGSRLFTLRLLFHHSPAVSFLTSPMLGSFSRGLPSLRDLPGADALFVPAFAVFLSAVSIFYF
Ga0247523_11659613300023684SoilAAVFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPGPDSRFVPPFGVFLLAGSTFYF
Ga0247517_11347323300023689SoilMIFFRVSAISTGSAAVFDSAFAPCHGSRLFTLRLPFNHSPAVSFLTSPTLGSFSRGLPSLRDLPGADALFVPAFAVFLLPVSTFYF
Ga0209483_115419013300025862Arctic Peat SoilFGGAFARRHGSRLFTLKLLFIHSPAVSFLTSPVLGSFSRGLPGLRVLPDAHALFVPPFGVFYLAVPTFLFLNPPEPSDRADTQ
Ga0222748_106831423300029701SoilMIFFRVSTISTGSAAAFDGAFARCHGSRLFTFRLPFHHSPAVSFLTSPTLGSFSRGLPSLRDLPGADALFVPPFGVFLLAVSTFYF
Ga0302173_1033018413300030055FenMIFFRVSTISTGSAAAFDGAFARCHGSRLFTLRLLFHHSPAVSFLTSPALGSFSRGLPSRSVLPGANAHF
Ga0311370_1205095923300030503PalsaGSAAVFGSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPGPDSRFVPPFGVFLLADPTFYF
Ga0210266_109033913300030536SoilISTGSAAAFDGAFARCHGSRLFTFRLPFHHSPAVSFLTSPALGSFSRGLPSLRDLPGADALFVPAFAVFLLAVSTFYF
Ga0210271_1020796613300030545SoilMIFFRVSTISTRSAAAFDGAFARCHGSRLFTFRLLFHHSPAVSFLTSPALGSFSRGLPSLRDLPGADALFVPAFAVFLLAVSTFYF
Ga0210272_125169513300030573SoilISTGSAAAFDSAFARRHGSRLFTHRLLFSHSPAVSFLTSPVLGSFSRDLPGRRVLPGANAHFVPPFGVSLWLIPFFA
Ga0210283_145358513300030588SoilAAFDGAFARCHGSRLFTFRLLFHHSPAVSFLTSPALGSFSRGLPSLRDLPGADALFVPAFAVFLLAVSTFYF
Ga0210255_1018416413300030589SoilTISTGSAAAFDGAFARCHGSRLFTFRLPFHHSPAVSFLTSPALGSFSRGLPSLRGLPGANAHFVPPFSVFRLADLRFFA
Ga0210276_1017194013300030595SoilSTISTGSAAAFDGAFARCHGSRLFTFRLLFHHSPAVSFLTSPTLGSFSRGLPSLRGLPGANAHFVTPFGVFRLADHADA
Ga0307482_115303023300030730Hardwood Forest SoilMIFFGVSTISTGSAAAFDSAFARCHGSRLFTFRLHFHHSPAVSFLTSPALGSFSRGLPSLRDLPGVDALFVPAFAVFLLAVSTFYFLNPPESSVRADAQ
Ga0307482_116888413300030730Hardwood Forest SoilMIFFRVSTISTGSAASFDSAYARCHGSRLFTYRLLFHHSPAVLFLTSPALGSFSRGLPSLRDLPGANALFVPPFGVFLLAVSTFYF
Ga0307482_126115313300030730Hardwood Forest SoilVFDSAFAPCHGSRLFTLRLLFNHSPAVSFLTSPALGSFSRGLPSLRDLPGANAHFVPPFGVFRLAVSTFYF
Ga0265763_102807713300030763SoilMIFFRVSTISTGSAAVFDSAFARCHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSHGLPSLSGLPDPDSRFVPPFGVFLLAGSTFYF
Ga0075396_103981823300030776SoilMIFFRVSTISTGSAADFVGAFARCHGSRLFTFRLLFHHSPAVSFLTSPALGSFSRGLPSLRDLPGTDALFVPPFGVFLLAVSTFYF
Ga0265756_11503813300030805SoilMIFFRVSAISTGSAAAFNSAFARCHGSRLFTFRLHFHHSPAVSFLTSPALGSFSRGLPGLRVLPGPDSHFVPPFGVFLLADGAFGAPPPESSIRADTQ
Ga0265746_106564723300030815SoilSTGSAAAFDGAFARCHGSRLFTLKLLFFHSPAVSFLTSPTLGSLSRGLPSLRGLPGANARFVPPFGVFLLANSTFYF
Ga0265726_10299923300030824SoilSTGSAAVFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTLGSFSRGLPSLRGLPGPDSRFVPPFGVFLLADPTFYF
Ga0075384_1010745323300030841SoilMIFIRVSTISTGSAAAFDGAFARCHGSRLFTLRLPFHHSPAVSFLTSPALGSFSHGLPSLRDLPGAYALFVPAFAVFLLAVSTFYF
Ga0075397_1003628413300030845SoilMILIRVSTISTGSAAAFDGAFARCHGSRLFTLRLPFHHSPAVSFLTSPALGSFSHGLPSLRDLPGAYALFVPAFAVFLLAVSTFYF
Ga0075393_1004293123300030849SoilAAVFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPGPDSRFVPPFGVFLLADSTFYF
Ga0075387_1178721823300030850SoilVSTISTGSAAAFDGAFARCHGSRLFTFRLHFHHSPAVSFLTSPALGSFSRGLPSLRDLPSADALFVPPFGVFLLAVSTFYF
Ga0075389_1001006413300030852SoilRVSTISTGSAAAFDGAFARCHGSRLFTLRLPFHHSPAVSFLTSPALGSFSRGLPSLRDLPVADALFVPAFAVFLLAVSTFYF
Ga0075372_1006719623300030853SoilMIFFRVSTISTGSAAVFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPGPDSRFVPPFSVFLLADPTFYF
Ga0075385_1003737013300030854SoilAAVFDSAFAPCHGSRLFTLRLLFIHSPAVSFLTSPALGRFSRGLPSLRVLPGANALFVPPFGVFLLAVPTFYF
Ga0075374_1002962623300030855SoilFRVSTISTGSAAVFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPGSDSRFVPPFGVFLSAGPTFYFRIPPESSVRADAQ
Ga0265753_112836113300030862SoilISTGSAAVFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPMLGSFSRGLPSLRGLPDPDSRFVPPFGVFLLADPTFF
Ga0265743_11247013300030885SoilLASTGGCATNLRTRLRHAYDFFRVSTISTGSAAVFDSAFARCHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSHGLPSLRGLPDPDSRFVPPFGVFLLAGSTFYF
Ga0265772_10738313300030886SoilMIFFRVSTISTGSAAVFDSAFARRHGSRLFTLKLLFFHSPAVPFLTSPTPGSFSRGLPSLRGLPGPDSRFVPPFGVFLSAGPTFYF
Ga0075379_1004158523300030946SoilMIFFRVSTISTGSAAAFDSAFARCHGSRLFTFRLHFHHSPAVSFLTSPALGSFSRGLPSLRDLPSADALFVPPFGVFLLAVSTFYF
Ga0075390_1006264023300030947SoilGSAAVFDSAFAPCHGSRLFTLRLLFIHSPAVSFLTSPMLGSFSRGLPSLRVLPGADALFVPPFGVFLLAVPTFYF
Ga0074034_1007169123300030950SoilISTGSAAVFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPAPGSFSRGLPSLRGLPGPDSRFVPPFGVFLLADSTFYF
Ga0074034_1129050013300030950SoilFFRVSTISTGSAAAFDSAFAPCHGSRLFTLKLLFNHSPAVSFLTSPTLGSFSRGLPSLRGLPGANALFVPPFSVFLLAVPTFYF
Ga0265768_11021213300030963SoilASTGGCATNLRTRLRHAYDFFRVSTISTGSAAVFDSAFARCHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSHGLPSLRGLPDPDSRFVPPFGVFLLAGSTFYF
Ga0075381_1157464013300030970SoilRVSTISTGSAAAFDGAFARCHGSRLFTLRLPFHHSPAVSFLTSPALGSFSHGLPSLRDLPGAYALFVPAFAVFLLAVSTFYF
Ga0265721_101315913300030977SoilIGAGSAAAFGSAFAQYHGSRLFTLRLHYIYSPAVLFLTSPGFGSFSRGLPSLRGLPGSNAHFVPPFGVFRLAVPLFILDPPESFVRADTQ
Ga0138298_153204213300031015SoilISTGSAAAFDGAFARCHGSRLFTFRLPFYHSPAVSFLTSPALGSFSRGLPSLLDLPGADALFIPAFAVFLLAVSTFYF
Ga0170834_10326996223300031057Forest SoilMILIRVSTISTGSAAAFDGAFARCHGSRLFTLRLPFHHSPAVSFLTSPALGSFSRGLPSLRDLPVADALFVPAFAVFLLAVSTFYF
Ga0302324_10302504323300031236PalsaFRVSTISTGSAAVFGSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTPGSFSRGLPSLRGLPGPDSRFVPPFGVFLLADPTFYF
Ga0170820_1024285113300031446Forest SoilMIFIRVSTISTGSAAAFDGAFALCHGSRLFTLRLPFHHSPAVSFLTSPALGSFSHGLPSLRDLPGAYALFVPAFAVFLLAVSTFYF
Ga0170819_1802947123300031469Forest SoilIRVSTISTGSAAAFDGAFALCHGSRLFTLRLPFHHSPAVSFLTSPALGSFSHGLPSLRDLPGAYALFVPAFAVFLLAVSTFYF
Ga0310102_10753913300031632SoilIFFRVSTISTGSAAVFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTLGSFSRGLPSLRGLPGPDSRFVPPFGVFLSAGPTFYF
Ga0310118_12060823300031664SoilISTGSAAVFDSAFARRHGSRLFTLKLLFFHSPAVSFLTSPTLGSFSRGLPSLRGLPGPDSRFVPPFGVFLLADPTFYF
Ga0316217_1000334583300031813FreshwaterMILFRVSTISTGSAAAFDGAFARCHGSRLFTLRLLFHHSPAVSFLTSPALGSFSRGLPSLRDLPGANALFVPPFSVFLLAVPTFYF
Ga0316036_10519013300031871SoilMIFFRVSAISTGSAAVFDSAFAPCHGSRLFTLRLPFNHSPAVSFLTSPTLGSFSRGLPSLRDLPGADALFVPAFAVFLSAVSIFYF
Ga0316036_11587413300031871SoilGSAAAFDGAFARCHGSRLFTLKLLFFHSPAVSFLTSPTPGSLSRGLPSLRGLPGANARFVPPFGVFLLANSTFYF
Ga0316032_10635123300031956SoilMIFFRVSTISTGSAAAFDSAFAQCHGSRLFTLRLLFHHSPAVSFLTSPMLGSFSRGLPSLRDLPGADALFVPAFAVFLLPVSTFYL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.