Basic Information | |
---|---|
Family ID | F032259 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 180 |
Average Sequence Length | 46 residues |
Representative Sequence | LVPSGDPVMLAKPVKASVYGFDKDKKLVGPSTVVLPAGWYVLPKE |
Number of Associated Samples | 143 |
Number of Associated Scaffolds | 180 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 13.97 % |
% of genes near scaffold ends (potentially truncated) | 68.89 % |
% of genes from short scaffolds (< 2000 bps) | 85.00 % |
Associated GOLD sequencing projects | 137 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (53.333 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (18.889 % of family members) |
Environment Ontology (ENVO) | Unclassified (48.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (40.556 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.25% Coil/Unstructured: 65.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 180 Family Scaffolds |
---|---|---|
PF00436 | SSB | 0.56 |
PF00149 | Metallophos | 0.56 |
PF13884 | Peptidase_S74 | 0.56 |
PF12684 | DUF3799 | 0.56 |
COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
---|---|---|---|
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.56 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 58.33 % |
Unclassified | root | N/A | 41.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000792|BS_KBA_SWE02_21mDRAFT_10126282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300000882|FwDRAFT_10041735 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 3684 | Open in IMG/M |
3300000883|EsDRAFT_10119562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2808 | Open in IMG/M |
3300000929|NpDRAFT_10280290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300004796|Ga0007763_10827909 | Not Available | 581 | Open in IMG/M |
3300005527|Ga0068876_10645612 | Not Available | 570 | Open in IMG/M |
3300005739|Ga0076948_1054974 | Not Available | 1908 | Open in IMG/M |
3300005805|Ga0079957_1301667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
3300005805|Ga0079957_1315450 | Not Available | 697 | Open in IMG/M |
3300005992|Ga0073924_1056088 | Not Available | 577 | Open in IMG/M |
3300006007|Ga0073917_1016638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300006637|Ga0075461_10229264 | Not Available | 549 | Open in IMG/M |
3300006637|Ga0075461_10251805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300006917|Ga0075472_10054852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1895 | Open in IMG/M |
3300006917|Ga0075472_10219805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
3300007363|Ga0075458_10044753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1395 | Open in IMG/M |
3300007363|Ga0075458_10159226 | Not Available | 698 | Open in IMG/M |
3300007538|Ga0099851_1127165 | Not Available | 959 | Open in IMG/M |
3300007541|Ga0099848_1271197 | Not Available | 588 | Open in IMG/M |
3300007544|Ga0102861_1093089 | Not Available | 802 | Open in IMG/M |
3300007554|Ga0102820_1121581 | Not Available | 628 | Open in IMG/M |
3300007559|Ga0102828_1080537 | Not Available | 780 | Open in IMG/M |
3300007562|Ga0102915_1249170 | Not Available | 574 | Open in IMG/M |
3300007649|Ga0102912_1147532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300007651|Ga0102900_1091383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300007708|Ga0102859_1033830 | Not Available | 1382 | Open in IMG/M |
3300007708|Ga0102859_1218481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300007708|Ga0102859_1221649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300007864|Ga0105749_1096405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300007972|Ga0105745_1087964 | Not Available | 901 | Open in IMG/M |
3300007973|Ga0105746_1005940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3377 | Open in IMG/M |
3300008055|Ga0108970_11258106 | Not Available | 864 | Open in IMG/M |
3300008107|Ga0114340_1141119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
3300008266|Ga0114363_1176398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1163 | Open in IMG/M |
3300008266|Ga0114363_1210749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300008266|Ga0114363_1231068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300008267|Ga0114364_1155749 | Not Available | 621 | Open in IMG/M |
3300008459|Ga0114865_1118678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
3300009024|Ga0102811_1239192 | Not Available | 678 | Open in IMG/M |
3300009026|Ga0102829_1073982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
3300009051|Ga0102864_1202531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300009056|Ga0102860_1113019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
3300009152|Ga0114980_10023096 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 3871 | Open in IMG/M |
3300009152|Ga0114980_10274250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
3300009158|Ga0114977_10048269 | Not Available | 2641 | Open in IMG/M |
3300009158|Ga0114977_10657508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300009159|Ga0114978_10265211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1062 | Open in IMG/M |
3300009165|Ga0105102_10741492 | Not Available | 555 | Open in IMG/M |
3300009168|Ga0105104_10069015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1911 | Open in IMG/M |
3300009183|Ga0114974_10650061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300009807|Ga0105061_1042311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300009819|Ga0105087_1051652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300010354|Ga0129333_10534426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
3300010354|Ga0129333_10553174 | Not Available | 1003 | Open in IMG/M |
3300010354|Ga0129333_10594097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
3300010885|Ga0133913_12093620 | Not Available | 1401 | Open in IMG/M |
3300011268|Ga0151620_1099285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300011995|Ga0153800_1035624 | Not Available | 530 | Open in IMG/M |
3300012013|Ga0153805_1077642 | Not Available | 563 | Open in IMG/M |
3300012708|Ga0157595_1049160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10615528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
(restricted) 3300013128|Ga0172366_10514710 | Not Available | 716 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10623809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
(restricted) 3300013133|Ga0172362_10046425 | Not Available | 3416 | Open in IMG/M |
3300013372|Ga0177922_10841360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1437 | Open in IMG/M |
3300017707|Ga0181363_1064836 | Not Available | 637 | Open in IMG/M |
3300017736|Ga0181365_1160037 | Not Available | 531 | Open in IMG/M |
3300017736|Ga0181365_1164122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300017747|Ga0181352_1132421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300017747|Ga0181352_1182308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300017754|Ga0181344_1021232 | Not Available | 2015 | Open in IMG/M |
3300017754|Ga0181344_1119106 | Not Available | 761 | Open in IMG/M |
3300017754|Ga0181344_1130199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300017774|Ga0181358_1051367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1559 | Open in IMG/M |
3300017774|Ga0181358_1089547 | Not Available | 1115 | Open in IMG/M |
3300017777|Ga0181357_1159909 | Not Available | 825 | Open in IMG/M |
3300017777|Ga0181357_1183786 | Not Available | 754 | Open in IMG/M |
3300017780|Ga0181346_1130145 | Not Available | 957 | Open in IMG/M |
3300017780|Ga0181346_1169559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300017780|Ga0181346_1293702 | Not Available | 554 | Open in IMG/M |
3300017784|Ga0181348_1231571 | Not Available | 647 | Open in IMG/M |
3300017784|Ga0181348_1319714 | Not Available | 514 | Open in IMG/M |
3300017785|Ga0181355_1123875 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
3300018420|Ga0181563_10393726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300019784|Ga0181359_1227485 | Not Available | 582 | Open in IMG/M |
3300020176|Ga0181556_1093066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1392 | Open in IMG/M |
3300020183|Ga0194115_10084357 | Not Available | 1828 | Open in IMG/M |
3300020196|Ga0194124_10103055 | Not Available | 1619 | Open in IMG/M |
3300020205|Ga0211731_11403305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
3300020556|Ga0208486_1022900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
3300021091|Ga0194133_10502473 | Not Available | 627 | Open in IMG/M |
3300021312|Ga0210306_1142683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300021317|Ga0210309_1123011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 971 | Open in IMG/M |
3300021600|Ga0194059_1197430 | Not Available | 607 | Open in IMG/M |
3300021600|Ga0194059_1214662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300021961|Ga0222714_10342702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
3300021963|Ga0222712_10303904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
3300021963|Ga0222712_10322658 | Not Available | 961 | Open in IMG/M |
3300021963|Ga0222712_10476423 | Not Available | 743 | Open in IMG/M |
3300022179|Ga0181353_1132134 | Not Available | 588 | Open in IMG/M |
3300022200|Ga0196901_1158263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300022407|Ga0181351_1003726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5582 | Open in IMG/M |
3300022407|Ga0181351_1103384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1097 | Open in IMG/M |
3300022407|Ga0181351_1177075 | Not Available | 738 | Open in IMG/M |
3300024348|Ga0244776_10511933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
3300024554|Ga0255242_1001209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5522 | Open in IMG/M |
3300025635|Ga0208147_1144656 | Not Available | 556 | Open in IMG/M |
3300025732|Ga0208784_1041555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1434 | Open in IMG/M |
3300027128|Ga0255099_1000604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14310 | Open in IMG/M |
3300027154|Ga0255111_1076982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
3300027213|Ga0208555_1073856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300027492|Ga0255093_1049000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
3300027494|Ga0255094_1002923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6145 | Open in IMG/M |
3300027578|Ga0255075_1074927 | Not Available | 594 | Open in IMG/M |
3300027588|Ga0255101_1003431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3004 | Open in IMG/M |
3300027675|Ga0209077_1140865 | Not Available | 673 | Open in IMG/M |
3300027733|Ga0209297_1010187 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 4613 | Open in IMG/M |
3300027733|Ga0209297_1194719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
3300027759|Ga0209296_1159054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1007 | Open in IMG/M |
3300027782|Ga0209500_10079271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1671 | Open in IMG/M |
3300027782|Ga0209500_10337756 | Not Available | 626 | Open in IMG/M |
3300027793|Ga0209972_10359500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300027798|Ga0209353_10289002 | Not Available | 697 | Open in IMG/M |
3300027805|Ga0209229_10001035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium | 11392 | Open in IMG/M |
3300027808|Ga0209354_10283638 | Not Available | 661 | Open in IMG/M |
3300027816|Ga0209990_10473509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300031566|Ga0307378_11134944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300031707|Ga0315291_10575378 | Not Available | 1027 | Open in IMG/M |
3300031746|Ga0315293_11231085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300031758|Ga0315907_10104715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2423 | Open in IMG/M |
3300031758|Ga0315907_10998976 | Not Available | 604 | Open in IMG/M |
3300031834|Ga0315290_10267473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1494 | Open in IMG/M |
3300031873|Ga0315297_11075177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300031885|Ga0315285_10651492 | Not Available | 687 | Open in IMG/M |
3300031951|Ga0315904_10178112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2115 | Open in IMG/M |
3300031951|Ga0315904_11312770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300031952|Ga0315294_11301285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300031963|Ga0315901_10174477 | All Organisms → Viruses → Predicted Viral | 1889 | Open in IMG/M |
3300031963|Ga0315901_10672590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Alicycliphilus → Alicycliphilus denitrificans | 772 | Open in IMG/M |
3300031997|Ga0315278_11207839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
3300031997|Ga0315278_12010410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300031999|Ga0315274_10901242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
3300032053|Ga0315284_10130799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3325 | Open in IMG/M |
3300032053|Ga0315284_10194640 | Not Available | 2628 | Open in IMG/M |
3300032092|Ga0315905_10988261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300032092|Ga0315905_11621356 | Not Available | 501 | Open in IMG/M |
3300032118|Ga0315277_10726987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
3300032516|Ga0315273_10469756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1688 | Open in IMG/M |
3300033816|Ga0334980_0288538 | Not Available | 639 | Open in IMG/M |
3300033980|Ga0334981_0011369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5050 | Open in IMG/M |
3300033981|Ga0334982_0009973 | Not Available | 5652 | Open in IMG/M |
3300033992|Ga0334992_0001369 | All Organisms → cellular organisms → Bacteria | 19340 | Open in IMG/M |
3300034019|Ga0334998_0192100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1275 | Open in IMG/M |
3300034020|Ga0335002_0655663 | Not Available | 534 | Open in IMG/M |
3300034021|Ga0335004_0190473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1288 | Open in IMG/M |
3300034022|Ga0335005_0223191 | All Organisms → Viruses → Predicted Viral | 1157 | Open in IMG/M |
3300034061|Ga0334987_0240999 | Not Available | 1239 | Open in IMG/M |
3300034061|Ga0334987_0508631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300034061|Ga0334987_0679487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300034062|Ga0334995_0057012 | Not Available | 3149 | Open in IMG/M |
3300034063|Ga0335000_0660743 | Not Available | 579 | Open in IMG/M |
3300034064|Ga0335001_0003091 | Not Available | 10006 | Open in IMG/M |
3300034068|Ga0334990_0546030 | Not Available | 613 | Open in IMG/M |
3300034082|Ga0335020_0005121 | Not Available | 8416 | Open in IMG/M |
3300034101|Ga0335027_0856176 | Not Available | 521 | Open in IMG/M |
3300034102|Ga0335029_0425037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300034105|Ga0335035_0059881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2499 | Open in IMG/M |
3300034106|Ga0335036_0130307 | Not Available | 1812 | Open in IMG/M |
3300034116|Ga0335068_0496350 | Not Available | 566 | Open in IMG/M |
3300034117|Ga0335033_0351389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300034118|Ga0335053_0674197 | Not Available | 585 | Open in IMG/M |
3300034120|Ga0335056_0346096 | Not Available | 812 | Open in IMG/M |
3300034120|Ga0335056_0643855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300034168|Ga0335061_0547546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300034200|Ga0335065_0038533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3352 | Open in IMG/M |
3300034272|Ga0335049_0427657 | Not Available | 861 | Open in IMG/M |
3300034280|Ga0334997_0746856 | Not Available | 592 | Open in IMG/M |
3300034284|Ga0335013_0154245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1559 | Open in IMG/M |
3300034356|Ga0335048_0461582 | Not Available | 616 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.89% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.11% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 10.00% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.33% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.67% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.11% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.44% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.89% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.78% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.22% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.22% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.67% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.67% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.67% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.11% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.11% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.11% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.11% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.11% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.56% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.56% |
Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.56% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.56% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.56% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.56% |
Freshwater And Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine | 0.56% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.56% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.56% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.56% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300000883 | Estuary microbial communities from the Columbia River - 5 PSU | Environmental | Open in IMG/M |
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005992 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 | Environmental | Open in IMG/M |
3300006007 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_23-Sept-14 | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
3300007649 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 | Environmental | Open in IMG/M |
3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008459 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs | Environmental | Open in IMG/M |
3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012708 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
3300021312 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021317 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021325 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024554 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027128 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d | Environmental | Open in IMG/M |
3300027154 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027492 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d | Environmental | Open in IMG/M |
3300027494 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d | Environmental | Open in IMG/M |
3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
3300027588 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d | Environmental | Open in IMG/M |
3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
BS_KBA_SWE02_21mDRAFT_101262823 | 3300000792 | Marine | PSGDPVMLAKPTRASVYGFDKDKKLVGPSTVTLPAGWYVLPKSQ* |
FwDRAFT_100417354 | 3300000882 | Freshwater And Marine | VPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKN* |
EsDRAFT_101195621 | 3300000883 | Freshwater And Marine | LVPNGDPVMLAEPTKASVYSFDSNKKLVGPSRVVLPAGWYVLPKQ* |
NpDRAFT_102802901 | 3300000929 | Freshwater And Marine | GDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKN* |
Ga0007763_108279091 | 3300004796 | Freshwater Lake | PVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK* |
Ga0068876_106456122 | 3300005527 | Freshwater Lake | MVPNGDPVMLAAPTKASVYSFDKDKKLVGPATVVIPAGWYALPKSK* |
Ga0076948_10549741 | 3300005739 | Lake Water | AKPTKAKVYAFDKDQKLVGPSTVTLPAGWYALPKTK* |
Ga0079957_13016674 | 3300005805 | Lake | VVLVPSGDPVMLAKPTRASVYGFDSNKKLVGPSTVVLPAGWYALPKN* |
Ga0079957_13154501 | 3300005805 | Lake | AKPVKASVYAFDKDKKLVGPSTVKLPAGWYVLPKQ* |
Ga0073924_10560882 | 3300005992 | Sand | MLVLPIFPACQTTVVMVPNGDPVMLAKPTKASVYSFDKNQKLVGPATVVIPAGWYALPKSK* |
Ga0073917_10166382 | 3300006007 | Sand | MLAEPVRARVYAFDKDKKLVGPSKVVLPAGWYVLPKN* |
Ga0075461_102292642 | 3300006637 | Aqueous | GDPVMLAKPTKAKVYAFDKDQKLVGPSTVTLPAGWYALPKTK* |
Ga0075461_102518053 | 3300006637 | Aqueous | VVLVPSGDPVMLAKPTKASVYSFDSNKKLVGPSTVVIPAGWYALPK* |
Ga0075472_100548521 | 3300006917 | Aqueous | MVPHGDPVMLAKPVKASVYAFDANKKLVGPSTVVIPAGWYALPK* |
Ga0075472_102198053 | 3300006917 | Aqueous | AKPTKASVYSFDSNKKLVGPSTVVIPAGWYALPK* |
Ga0075458_100447531 | 3300007363 | Aqueous | LPICLGCQQTKVVMVPHGDPVMIAAPVQASVYGFDKNKKLVGPSKVTLPAGWYVLPKQ* |
Ga0075458_101592262 | 3300007363 | Aqueous | MLAKPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK* |
Ga0099851_11271651 | 3300007538 | Aqueous | LAKPTKASVYSFDKNQKLVGPSTVIIPAGWYALPK* |
Ga0099848_12711972 | 3300007541 | Aqueous | MLAKPTKASVYSFDSNKKLVGPSTVVIPAGWYALPK* |
Ga0102861_10930892 | 3300007544 | Estuarine | MLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK* |
Ga0102820_11215811 | 3300007554 | Estuarine | CLGCQVTKVVLVPSGDPVMLAKPVKASVYSFDKNKKLVGPATVVIPAGWYALPKSK* |
Ga0102828_10805371 | 3300007559 | Estuarine | GDPVMLAKPVQASVYAFDADKKLVGPSRVTLPAGWYVLPKK* |
Ga0102915_12491701 | 3300007562 | Estuarine | KPVKASVYSFDANKKLVGPATVVIPAGWYALPKSK* |
Ga0102912_11475323 | 3300007649 | Estuarine | LALPIFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK |
Ga0102900_10913831 | 3300007651 | Estuarine | GDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK* |
Ga0102859_10338301 | 3300007708 | Estuarine | LGCQMTKVVLVPSGDPVMLAEPVKASVYGFDKDQKLVGPSRVTLPAGWYVLPKK* |
Ga0102859_12184811 | 3300007708 | Estuarine | LVPSGDPVMLAKPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKN* |
Ga0102859_12216492 | 3300007708 | Estuarine | VPSGDPVMLAKPTTASVYAFDADKKLVGPSNVVLPAGWYVLPKN* |
Ga0105749_10964051 | 3300007864 | Estuary Water | RVVLVPSGDPVMLAQPVKASVYGFDSDKKLVGPSNVVLPAGWYVLPKSQ* |
Ga0105745_10879644 | 3300007972 | Estuary Water | VPSGDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK* |
Ga0105746_10059401 | 3300007973 | Estuary Water | QPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKQ* |
Ga0108970_112581063 | 3300008055 | Estuary | MLAKPVKASVYSFDANKKLVGPSTVVIPAGWYALPKSK* |
Ga0114340_11411191 | 3300008107 | Freshwater, Plankton | AKPTKASVYSFDKNQKLVGPSTVILPAGWYALPK* |
Ga0114363_11763985 | 3300008266 | Freshwater, Plankton | MLAKPVKASVYSFDKNKKLVGPATVVIPAGWYALPKS |
Ga0114363_12107491 | 3300008266 | Freshwater, Plankton | MVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKS |
Ga0114363_12310681 | 3300008266 | Freshwater, Plankton | MLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKS |
Ga0114364_11557491 | 3300008267 | Freshwater, Plankton | IALLTCLGCQVTKVALVPSGDPVMLAKPVKASVYSFDKNKKLVGPATVVIPAGWYALPKSK* |
Ga0114865_11186783 | 3300008459 | Freshwater Lake | IALLTCLGCQVTKVALVPSGDPVMLAKPVKASVYSFDKDKKLVGPATVVIPAGWYALPKSK* |
Ga0102811_12391922 | 3300009024 | Estuarine | MLAKPVKASVYSFDKNKKLVGPATVVIPAGWYALPKSK* |
Ga0102829_10739821 | 3300009026 | Estuarine | QPVKASVYGFDKDKKLVGPSKVVLPAGWYVLPKN* |
Ga0102864_12025312 | 3300009051 | Estuarine | MLAKPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKQ* |
Ga0102860_11130194 | 3300009056 | Estuarine | MVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK* |
Ga0114980_100230966 | 3300009152 | Freshwater Lake | VPSGDPVMLAQPTTASVYGFDSDKKLVGPSKVTLPAGWYVLPKN* |
Ga0114980_102742502 | 3300009152 | Freshwater Lake | MTKVVLVPSGDPVMLARPTTASVYGFDKDKKLVGPSTVTLPAGWYVLPKSQ* |
Ga0114977_100482696 | 3300009158 | Freshwater Lake | AQPVKASVYAFDADKKLVGPSRVTLPAGWYVLPKK* |
Ga0114977_106575081 | 3300009158 | Freshwater Lake | MTKVVLVPSGDPVMLAQPVKASVYAFDADKKLVGPSRVTLPAG |
Ga0114978_102652113 | 3300009159 | Freshwater Lake | VPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVTLPAGWYVLPKN* |
Ga0105102_107414921 | 3300009165 | Freshwater Sediment | PNGDPVMLAEPIRARVYAFDKDGKLSGPDRVTLPAGWYVLPKTK* |
Ga0105104_100690151 | 3300009168 | Freshwater Sediment | LVPSGDPVMLAKPVKASVYGFDSNKKLVGPSTVTLPAGWYVLPKQ* |
Ga0114974_106500612 | 3300009183 | Freshwater Lake | AEPVRARVYAFDKDKKLVGPSRVVLPAGWYVLPKN* |
Ga0105061_10423111 | 3300009807 | Groundwater Sand | KVVLVPSGDPVMLAKPTKASVYGFDSDKKLVGPSRVVLPAGWYVLPKN* |
Ga0105087_10516522 | 3300009819 | Groundwater Sand | KPTTASVYGFDADKKLVGPSKVVLPAGWYVLPKN* |
Ga0129333_105344263 | 3300010354 | Freshwater To Marine Saline Gradient | SGDPVMLAKPTKASVYSFDKNQKLVGPSTVIIPAGWYALPK* |
Ga0129333_105531741 | 3300010354 | Freshwater To Marine Saline Gradient | KVVLVPSGDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK* |
Ga0129333_105940972 | 3300010354 | Freshwater To Marine Saline Gradient | MVPHGDPVMLAKPVKASVYAFDKDKRLVGPSRVTLPSGWYVLPKD* |
Ga0133913_120936201 | 3300010885 | Freshwater Lake | GDPVMLAQPVKASVYAFDADKKLVGPSRVTLPAGWYVLPKK* |
Ga0151620_10992851 | 3300011268 | Freshwater | MLAKPVKASVYAFDKDKKLVGPSRVELPAGWYVLPKSQ* |
Ga0153800_10356241 | 3300011995 | Freshwater | TKVVLVPSGDPVMLAKPVQASVYGFDSDKKLVGPSKVILPAGWYVLPKSQ* |
Ga0153805_10776423 | 3300012013 | Surface Ice | GDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKQ* |
Ga0157595_10491603 | 3300012708 | Freshwater | VMLAKPVKASVYGFDKDKKLVGPSTVTLPAGWYALPK* |
(restricted) Ga0172367_106155282 | 3300013126 | Freshwater | MTKVVLVPSGDPVMLAEPTRARVYAFDRDGKLVGPSTVKIPAGWYALPKAK* |
(restricted) Ga0172366_105147101 | 3300013128 | Sediment | LVPSGDPVMLAKPVKASVYGFDKDKKLVGPSTVVLPAGWYVLPKE* |
(restricted) Ga0172373_106238091 | 3300013131 | Freshwater | MLAKPIKASVYGFDRDKKLVGPSNVTLPAGWYVLPKD* |
(restricted) Ga0172362_100464256 | 3300013133 | Sediment | MLAKPIKASVYGFDRDKKLVGPSTVKIPAGWYALPKTK* |
Ga0177922_108413602 | 3300013372 | Freshwater | CQMTKVVLVPSGDPVMLAKPVKASVYGFDKDKKLVGPSTVVLPAGWYALPKN* |
Ga0181363_10648361 | 3300017707 | Freshwater Lake | MLAKPVKASVYAFDANKKLVGPSKVTLPAGWYVLPKN |
Ga0181365_11600371 | 3300017736 | Freshwater Lake | PSGDPVMLAKPATASVYGFDSDKKLVGPSKVVLPAGWYVLPKQ |
Ga0181365_11641221 | 3300017736 | Freshwater Lake | VVLVPSGDPVMLAQPVKASVYAFDADKKLVGPSRVTLPA |
Ga0181352_11324211 | 3300017747 | Freshwater Lake | QVTKVALVPSGDPVMLAKPVKASVYGFDKDKKLVGPATVVIPAGWYALPKSK |
Ga0181352_11823081 | 3300017747 | Freshwater Lake | MTKVVLVPSGDPVMLAKPVKASVYGFDSNKKLVGPSTVTLPAGWYALPKN |
Ga0181344_10212325 | 3300017754 | Freshwater Lake | PICLGCRTKVVLVPSGDPVLLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK |
Ga0181344_11191061 | 3300017754 | Freshwater Lake | LGCQMTKVVLVPSGDPVMLAKPTKASVYGFDKDKKLVGPSNVTLPAGWYVLPKN |
Ga0181344_11301992 | 3300017754 | Freshwater Lake | MLALPTFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKDKKLVGPATVVIPAGWYALPKS |
Ga0181358_10513673 | 3300017774 | Freshwater Lake | RVVLVPSGDPVMLAKPTTASVYGFDKDKKLVGPSKVVLPAGWYVLPKN |
Ga0181358_10895472 | 3300017774 | Freshwater Lake | VLPICLGCQMTRVVLVPSGDPVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKR |
Ga0181357_11599092 | 3300017777 | Freshwater Lake | VPSGDPVMLAQPVKASVYSFDSNKKLVGPSKVVLPAGWYVLPKQ |
Ga0181357_11837864 | 3300017777 | Freshwater Lake | CLGCQVTRVVLVPSGDPVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKR |
Ga0181346_11301453 | 3300017780 | Freshwater Lake | VLVPSGDPVMLALPVKASVYGFDSDKKLGGRSRVNLPAGWYVLTKK |
Ga0181346_11695591 | 3300017780 | Freshwater Lake | ALPIFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK |
Ga0181346_12937021 | 3300017780 | Freshwater Lake | VLPICLGCQMTKVVLVPSGDPVMLAEPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKQ |
Ga0181348_12315714 | 3300017784 | Freshwater Lake | CLGCQVTRVVLVPSGDPVMLAQPVKASVYGFDADKKLVGPSKVVLPAGWYVLPKQ |
Ga0181348_13197143 | 3300017784 | Freshwater Lake | PICLGCQVTRVVLVPSGDPVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKR |
Ga0181355_11238751 | 3300017785 | Freshwater Lake | TKVVLVPSGDPVMLAKPTKAKVYAFDKDQKLVGPSTVTLPAGWYALPKTK |
Ga0181563_103937261 | 3300018420 | Salt Marsh | PVMLAQPVKASIYSFDKNKKLVGPSTVIIPAGWYALPK |
Ga0181359_12274851 | 3300019784 | Freshwater Lake | GCLGCQQTKVVMVPHGDPVMLAKPTKASVYSFDSNKKLVGPSTVVIPAGWYALPK |
Ga0181556_10930666 | 3300020176 | Salt Marsh | MLAQPVKASIYSFDKNKKLVGPSTVIIPAGWYALPK |
Ga0194115_100843571 | 3300020183 | Freshwater Lake | LALPICLGCQMTKVVLVPHGDPVMLAKPVTASVYGFDRDKKLVGPSNVTLPAGWYVLPKE |
Ga0194124_101030551 | 3300020196 | Freshwater Lake | LVPHGDPVMLAKPVTASVYGFDKDKKLVGPSNVTLPAGWYVLPKE |
Ga0211731_114033051 | 3300020205 | Freshwater | QQTKVVLVPSGDPVMLAKPLKASVYGFDKDKKLVGPSTVTLPAGWYVLPKN |
Ga0208486_10229003 | 3300020556 | Freshwater | PVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKSQ |
Ga0194133_105024731 | 3300021091 | Freshwater Lake | GCQMTRVVLVPHGDPVMLAKPVTASVYGFDRDKKLVGPSNVTLPAGWYVLPKE |
Ga0210306_11426832 | 3300021312 | Estuarine | CQQTKVVLVPSGDPVMLAEPVKASVYGFDKDKKLVGPSKVVLPAGWYVLPKN |
Ga0210309_11230112 | 3300021317 | Estuarine | VLPICLGCQQTKVILVPNGDPVMLARPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKN |
Ga0210301_13496452 | 3300021325 | Estuarine | MAALLTCLGCQMTRVVLVPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPK |
Ga0194059_11974302 | 3300021600 | Anoxic Zone Freshwater | PVMLAEPVRARVYAFDKDGKLSGPSRVTLPAGWYVLPKAK |
Ga0194059_12146623 | 3300021600 | Anoxic Zone Freshwater | MLAEPVRARVYAFDKDGKLSGPSRVTLPAGWYVLP |
Ga0222714_103427022 | 3300021961 | Estuarine Water | MLALPIFPACQTTVVMVPNGDPVMLAKPVKASVYGFDKDKKLVGPATVVIPAGWYALPKS |
Ga0222712_103039041 | 3300021963 | Estuarine Water | LAQPVKASVYGFDSEKKLVGPSKVVLPAGWYVLPKN |
Ga0222712_103226583 | 3300021963 | Estuarine Water | VVLVPSGDPVMLAKPIKASVYAFDADKKLVGPSRVTLPAGWYVLPKK |
Ga0222712_104764232 | 3300021963 | Estuarine Water | MLAKPVKASVYSFDANKKLVGPATVVIPAGWYALPKSK |
Ga0181353_11321341 | 3300022179 | Freshwater Lake | RTKVVLVPSGDPIMLSEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKTK |
Ga0196901_11582633 | 3300022200 | Aqueous | VMLAKPTKASVYSFDSNKKLVGPSTVVIPAGWYALPK |
Ga0181351_10037264 | 3300022407 | Freshwater Lake | MLALPIFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKS |
Ga0181351_11033846 | 3300022407 | Freshwater Lake | MLAKPTTASVYGFDKDKKLVGPSKVVLPAGWYVLPKN |
Ga0181351_11770754 | 3300022407 | Freshwater Lake | VILVPNGDPVMLAEPVRARVYAFDKDKKLVGPSKVVLPAGWYVLPKQ |
Ga0244776_105119333 | 3300024348 | Estuarine | MVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK |
Ga0255242_10012093 | 3300024554 | Freshwater | VVLVPSGDPIMLAEPVRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK |
Ga0208147_11446561 | 3300025635 | Aqueous | LIALPICLGCQTKVVMVPHGDPVMLAKPVKASVYAFDANKKLVGPSTVVIPAGWYALPK |
Ga0208784_10415554 | 3300025732 | Aqueous | VPSGDPVMLAKPIKASVYAFDSNKKLVGPSRVELPAGWYVLPKSQ |
Ga0255099_100060410 | 3300027128 | Freshwater | PVMLAKPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK |
Ga0255111_10769823 | 3300027154 | Freshwater | PVMLAKPTKASVYSFDSNKKLVGPSTVVIPAGWYALPK |
Ga0208555_10738562 | 3300027213 | Estuarine | MLAFPIFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKS |
Ga0255093_10490001 | 3300027492 | Freshwater | VVLVPSGDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPK |
Ga0255094_10029231 | 3300027494 | Freshwater | LPIFPACQTTVVMVPNGDPVMLAKPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK |
Ga0255075_10749271 | 3300027578 | Freshwater | ALLTCLGCQVTKVALVPSGDPVMLAAPTKASVYSFDANKKLVGPATVVIPAGWYALPKSK |
Ga0255101_10034311 | 3300027588 | Freshwater | PNGDPVMLAKPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK |
Ga0209077_11408651 | 3300027675 | Freshwater Sediment | KVILVPSGDPVMLAEPVRARVYAFDKDGKLSGPDKVTLPAGWYVLPKTK |
Ga0209297_10101877 | 3300027733 | Freshwater Lake | VPSGDPVMLAQPTTASVYGFDSDKKLVGPSKVTLPAGWYVLPKN |
Ga0209297_11947193 | 3300027733 | Freshwater Lake | GCQMTKVVLVPSGDPVMLAQPVKASVYAFDADKKLVGPSRVTIPAGWYVLPKK |
Ga0209296_11590541 | 3300027759 | Freshwater Lake | MTKVVLVPSGDPVMLAQPVKASVYAFDADKKLVGPSKVVLPAG |
Ga0209500_100792713 | 3300027782 | Freshwater Lake | VPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVTLPAGWYVLPKN |
Ga0209500_103377561 | 3300027782 | Freshwater Lake | DPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKTK |
Ga0209972_103595003 | 3300027793 | Freshwater Lake | VVLVPNGDPVMLARPTKASVYGFDKDKKLVGPSTVILPAGWYALPK |
Ga0209353_102890021 | 3300027798 | Freshwater Lake | KVILVPNGDPVMLAEPVRARVYAFDKDKKLVGPSKVVLPAGWYVLPKQ |
Ga0209229_100010351 | 3300027805 | Freshwater And Sediment | KVVLVPSGDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK |
Ga0209354_102836384 | 3300027808 | Freshwater Lake | LAVLPICLGCQVTRVVLVPSGDPVMLAEPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPK |
Ga0209990_104735092 | 3300027816 | Freshwater Lake | MLALPIFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKDKKLVGPATVVIPAGWYALPKS |
Ga0307378_111349441 | 3300031566 | Soil | MLALPIFPACQTTVVMVPNGDPVMLAKPTKASVYSFDKNQKLVGPATVVIPAGWYALPKQ |
Ga0315291_105753783 | 3300031707 | Sediment | TCLGCQMTKVVLVPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKQ |
Ga0315293_112310852 | 3300031746 | Sediment | ALLTCLGCQVTRVVLVPSGDPVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKN |
Ga0315907_101047154 | 3300031758 | Freshwater | LVPNGDPVMLARPTKASVYGFDKDKKLVGPSTVILPAGWYALPK |
Ga0315907_109989763 | 3300031758 | Freshwater | VPSGDPVMLAKPVKASVYGFDKDKKLVGPSTVVLPAGWYVLPKSQ |
Ga0315290_102674731 | 3300031834 | Sediment | AEPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKN |
Ga0315297_110751771 | 3300031873 | Sediment | SGDPVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKSQ |
Ga0315285_106514921 | 3300031885 | Sediment | GCQMTKVVLVPSGDPVMLARPTKASVYSFDSNKKLVGPSRVVLPAGWYVLPKQ |
Ga0315904_101781124 | 3300031951 | Freshwater | TASLGCRTTVVLVPSGDPVMLAKPTKASVYSFDKNQKLVGPSTVIIPAGWYALPK |
Ga0315904_113127702 | 3300031951 | Freshwater | QMTKVVLVPSGDPVMLAKPTKASVYGFDKDKKLVGPSTVVLPAGWYALPKN |
Ga0315294_113012851 | 3300031952 | Sediment | MTKVVLVPSGDPVMLAKPVQASVYAFDADKKLVGPSRVTLPAGWYVLP |
Ga0315901_101744772 | 3300031963 | Freshwater | MLAAPTKASVYSFDKDKKLVGPATVVIPAGWYALPKSK |
Ga0315901_106725901 | 3300031963 | Freshwater | KVVLVPNGDPVMLAKPTKASVYGFDKDKKLVGPSTVTLPAGWYALPK |
Ga0315278_112078393 | 3300031997 | Sediment | PSGDPVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKSQ |
Ga0315278_120104101 | 3300031997 | Sediment | MLVLPICLGCQMTKVVLVPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPK |
Ga0315274_109012421 | 3300031999 | Sediment | GCQVTRVVLVPSGDPVMLAEPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKSQ |
Ga0315284_101307991 | 3300032053 | Sediment | LPICLGCQVTRVVMVPSGDPVMLAQPVKASVYGFDSDKKLVGPSRVVLPAGWYVLPKSQ |
Ga0315284_101946402 | 3300032053 | Sediment | MLAESVRARVYAFDKDGKLSGPSRVTLPAGWYVLPKAK |
Ga0315905_109882612 | 3300032092 | Freshwater | DCLGCQMTKVVLVPSGDPVMLAAPVKARVYAFDKDKKLVGPSTVVLPAGWYALPKN |
Ga0315905_116213561 | 3300032092 | Freshwater | ALPICLGCQQTKVVMVPHGDPVMIAAPVQASVYGFDKDKKLVGPSKVTLPAGWYVLPKQ |
Ga0315277_107269873 | 3300032118 | Sediment | EPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKSQ |
Ga0315273_104697561 | 3300032516 | Sediment | MLVLPICLGCQMTKVVLVPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKSQ |
Ga0334980_0288538_494_637 | 3300033816 | Freshwater | VLVPSGDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYVLPKTK |
Ga0334981_0011369_4911_5021 | 3300033980 | Freshwater | MLAKPVKASVYGFDSNKKLVGPSTVTLPAGWYALPK |
Ga0334982_0009973_5524_5634 | 3300033981 | Freshwater | MLAKPTKASVYSFDKNQKLVGPSTVIIPAGWYALPK |
Ga0334992_0001369_18653_18787 | 3300033992 | Freshwater | MVPHGEPVMLAKPVKASVYAFDQDKKLVGPSKVTLPAGWYVLPK |
Ga0334998_0192100_1162_1275 | 3300034019 | Freshwater | MLAKPTRASVYGFDSNKKLVGPSTVVLPAGWYALPKN |
Ga0335002_0655663_8_121 | 3300034020 | Freshwater | MLAKPVKASVYGFDSNKKLVGPSTVTLPAGWYVLPKQ |
Ga0335004_0190473_825_1004 | 3300034021 | Freshwater | MLTCLGCQVTKVVLVPSGDPVMLAKPTRASVYGFDKDKKLVGPSTVVIPAGWYALPKSK |
Ga0335005_0223191_1035_1157 | 3300034022 | Freshwater | PVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK |
Ga0334987_0240999_1114_1239 | 3300034061 | Freshwater | DPVMLAEPVRARVYAFDKDGKLSGPDKVTLPAGWYALPKTK |
Ga0334987_0508631_531_683 | 3300034061 | Freshwater | MTKVVLVPSGDPVMLAKPVKASVYGFDKDKKLVGPSTVTLPAGWYVLPKQ |
Ga0334987_0679487_22_138 | 3300034061 | Freshwater | MLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK |
Ga0334995_0057012_180_296 | 3300034062 | Freshwater | MLAEPVRARVYAFDKDGKLSGPSRVTLPAGWYVLPKAK |
Ga0335000_0660743_2_127 | 3300034063 | Freshwater | DPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK |
Ga0335001_0003091_9856_9969 | 3300034064 | Freshwater | MLAQPVKASVYAFDADKKLVGPSRVTLPAGWYVLPKK |
Ga0334990_0546030_1_117 | 3300034068 | Freshwater | MLAEPVRARVYAFDKDGKLSGPSRVILPAGWYVLPKAK |
Ga0335020_0005121_4125_4238 | 3300034082 | Freshwater | MLAKPVKASVYAFDADKKLVGPSRVTLPAGWYVLPKK |
Ga0335027_0856176_409_519 | 3300034101 | Freshwater | AKPTKASVYGFDKDQKLVGPSTVTLPAGWYALPKTK |
Ga0335029_0425037_2_136 | 3300034102 | Freshwater | VPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKN |
Ga0335035_0059881_1229_1411 | 3300034105 | Freshwater | MLALPIFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKQ |
Ga0335036_0130307_2_154 | 3300034106 | Freshwater | MTRVVLVPSGDPVMLAKPTTASVYAFDADKKLVGPSRVTLPAGWYVLPKK |
Ga0335068_0496350_26_178 | 3300034116 | Freshwater | MTKVVLVPSGDPVMLAKPTRASVYGFDSDKKLVGPSTVTLPAGWYALPKQ |
Ga0335033_0351389_578_721 | 3300034117 | Freshwater | VVLVPSGDPVMLAQPVKASVYGFDKDKKLVGPSKVVLPAGWYVLPKN |
Ga0335053_0674197_6_158 | 3300034118 | Freshwater | VTRVVLVPSGDPVMLAQPVKASVYAFDADKKLVGPSRVTLPAGWYVLPKK |
Ga0335056_0346096_4_156 | 3300034120 | Freshwater | VTKVVLVPSGDPVMLAKPVKASVYGFDKDKKLVGPSKVTLPAGWYALPKN |
Ga0335056_0643855_416_529 | 3300034120 | Freshwater | MLAKPVKASVYGFDKDKKLVGPSTVTLPAGWYVLPKN |
Ga0335061_0547546_406_558 | 3300034168 | Freshwater | MTKVVLVPSGDPVMLAEPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKN |
Ga0335065_0038533_2099_2215 | 3300034200 | Freshwater | MLAKPTKASVYSFDKNQKLVGPATVVIPAGWYALPKSK |
Ga0335049_0427657_2_166 | 3300034272 | Freshwater | LGCQQTKVVLVPSGDPVMLAKPVQASVYAFDADKKLVGPSRVTLPAGWYVLPKK |
Ga0334997_0746856_459_590 | 3300034280 | Freshwater | SGDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK |
Ga0335013_0154245_1447_1557 | 3300034284 | Freshwater | LAKPTRASVYGFDSNKKLVGPSTVTLPAGWYALPKN |
Ga0335048_0461582_3_146 | 3300034356 | Freshwater | VLVPSGDPVMLAKPVKASVYGFDSNKKLVGPSTVTLPAGWYVLPKSQ |
⦗Top⦘ |