NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F032259

Metagenome / Metatranscriptome Family F032259

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032259
Family Type Metagenome / Metatranscriptome
Number of Sequences 180
Average Sequence Length 46 residues
Representative Sequence LVPSGDPVMLAKPVKASVYGFDKDKKLVGPSTVVLPAGWYVLPKE
Number of Associated Samples 143
Number of Associated Scaffolds 180

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 13.97 %
% of genes near scaffold ends (potentially truncated) 68.89 %
% of genes from short scaffolds (< 2000 bps) 85.00 %
Associated GOLD sequencing projects 137
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (53.333 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(18.889 % of family members)
Environment Ontology (ENVO) Unclassified
(48.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(40.556 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 34.25%    Coil/Unstructured: 65.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 180 Family Scaffolds
PF00436SSB 0.56
PF00149Metallophos 0.56
PF13884Peptidase_S74 0.56
PF12684DUF3799 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 180 Family Scaffolds
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 0.56
COG2965Primosomal replication protein NReplication, recombination and repair [L] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.33 %
UnclassifiedrootN/A41.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000792|BS_KBA_SWE02_21mDRAFT_10126282All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage639Open in IMG/M
3300000882|FwDRAFT_10041735All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon3684Open in IMG/M
3300000883|EsDRAFT_10119562All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2808Open in IMG/M
3300000929|NpDRAFT_10280290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300004796|Ga0007763_10827909Not Available581Open in IMG/M
3300005527|Ga0068876_10645612Not Available570Open in IMG/M
3300005739|Ga0076948_1054974Not Available1908Open in IMG/M
3300005805|Ga0079957_1301667All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage720Open in IMG/M
3300005805|Ga0079957_1315450Not Available697Open in IMG/M
3300005992|Ga0073924_1056088Not Available577Open in IMG/M
3300006007|Ga0073917_1016638All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage725Open in IMG/M
3300006637|Ga0075461_10229264Not Available549Open in IMG/M
3300006637|Ga0075461_10251805All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300006917|Ga0075472_10054852All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1895Open in IMG/M
3300006917|Ga0075472_10219805All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage934Open in IMG/M
3300007363|Ga0075458_10044753All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1395Open in IMG/M
3300007363|Ga0075458_10159226Not Available698Open in IMG/M
3300007538|Ga0099851_1127165Not Available959Open in IMG/M
3300007541|Ga0099848_1271197Not Available588Open in IMG/M
3300007544|Ga0102861_1093089Not Available802Open in IMG/M
3300007554|Ga0102820_1121581Not Available628Open in IMG/M
3300007559|Ga0102828_1080537Not Available780Open in IMG/M
3300007562|Ga0102915_1249170Not Available574Open in IMG/M
3300007649|Ga0102912_1147532All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage676Open in IMG/M
3300007651|Ga0102900_1091383All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage655Open in IMG/M
3300007708|Ga0102859_1033830Not Available1382Open in IMG/M
3300007708|Ga0102859_1218481All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage569Open in IMG/M
3300007708|Ga0102859_1221649All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300007864|Ga0105749_1096405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300007972|Ga0105745_1087964Not Available901Open in IMG/M
3300007973|Ga0105746_1005940All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3377Open in IMG/M
3300008055|Ga0108970_11258106Not Available864Open in IMG/M
3300008107|Ga0114340_1141119All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage902Open in IMG/M
3300008266|Ga0114363_1176398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1163Open in IMG/M
3300008266|Ga0114363_1210749All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300008266|Ga0114363_1231068All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300008267|Ga0114364_1155749Not Available621Open in IMG/M
3300008459|Ga0114865_1118678All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage873Open in IMG/M
3300009024|Ga0102811_1239192Not Available678Open in IMG/M
3300009026|Ga0102829_1073982All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1043Open in IMG/M
3300009051|Ga0102864_1202531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300009056|Ga0102860_1113019All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage757Open in IMG/M
3300009152|Ga0114980_10023096All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon3871Open in IMG/M
3300009152|Ga0114980_10274250All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage982Open in IMG/M
3300009158|Ga0114977_10048269Not Available2641Open in IMG/M
3300009158|Ga0114977_10657508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300009159|Ga0114978_10265211All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1062Open in IMG/M
3300009165|Ga0105102_10741492Not Available555Open in IMG/M
3300009168|Ga0105104_10069015All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1911Open in IMG/M
3300009183|Ga0114974_10650061All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300009807|Ga0105061_1042311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage675Open in IMG/M
3300009819|Ga0105087_1051652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage675Open in IMG/M
3300010354|Ga0129333_10534426All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1024Open in IMG/M
3300010354|Ga0129333_10553174Not Available1003Open in IMG/M
3300010354|Ga0129333_10594097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage961Open in IMG/M
3300010885|Ga0133913_12093620Not Available1401Open in IMG/M
3300011268|Ga0151620_1099285All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage919Open in IMG/M
3300011995|Ga0153800_1035624Not Available530Open in IMG/M
3300012013|Ga0153805_1077642Not Available563Open in IMG/M
3300012708|Ga0157595_1049160All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage602Open in IMG/M
(restricted) 3300013126|Ga0172367_10615528All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
(restricted) 3300013128|Ga0172366_10514710Not Available716Open in IMG/M
(restricted) 3300013131|Ga0172373_10623809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage642Open in IMG/M
(restricted) 3300013133|Ga0172362_10046425Not Available3416Open in IMG/M
3300013372|Ga0177922_10841360All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1437Open in IMG/M
3300017707|Ga0181363_1064836Not Available637Open in IMG/M
3300017736|Ga0181365_1160037Not Available531Open in IMG/M
3300017736|Ga0181365_1164122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage523Open in IMG/M
3300017747|Ga0181352_1132421All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage667Open in IMG/M
3300017747|Ga0181352_1182308All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300017754|Ga0181344_1021232Not Available2015Open in IMG/M
3300017754|Ga0181344_1119106Not Available761Open in IMG/M
3300017754|Ga0181344_1130199All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage723Open in IMG/M
3300017774|Ga0181358_1051367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1559Open in IMG/M
3300017774|Ga0181358_1089547Not Available1115Open in IMG/M
3300017777|Ga0181357_1159909Not Available825Open in IMG/M
3300017777|Ga0181357_1183786Not Available754Open in IMG/M
3300017780|Ga0181346_1130145Not Available957Open in IMG/M
3300017780|Ga0181346_1169559All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage805Open in IMG/M
3300017780|Ga0181346_1293702Not Available554Open in IMG/M
3300017784|Ga0181348_1231571Not Available647Open in IMG/M
3300017784|Ga0181348_1319714Not Available514Open in IMG/M
3300017785|Ga0181355_1123875All Organisms → Viruses → Predicted Viral1056Open in IMG/M
3300018420|Ga0181563_10393726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage792Open in IMG/M
3300019784|Ga0181359_1227485Not Available582Open in IMG/M
3300020176|Ga0181556_1093066All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1392Open in IMG/M
3300020183|Ga0194115_10084357Not Available1828Open in IMG/M
3300020196|Ga0194124_10103055Not Available1619Open in IMG/M
3300020205|Ga0211731_11403305All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage848Open in IMG/M
3300020556|Ga0208486_1022900All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage953Open in IMG/M
3300021091|Ga0194133_10502473Not Available627Open in IMG/M
3300021312|Ga0210306_1142683All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage798Open in IMG/M
3300021317|Ga0210309_1123011All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage971Open in IMG/M
3300021600|Ga0194059_1197430Not Available607Open in IMG/M
3300021600|Ga0194059_1214662All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage578Open in IMG/M
3300021961|Ga0222714_10342702All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage806Open in IMG/M
3300021963|Ga0222712_10303904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage999Open in IMG/M
3300021963|Ga0222712_10322658Not Available961Open in IMG/M
3300021963|Ga0222712_10476423Not Available743Open in IMG/M
3300022179|Ga0181353_1132134Not Available588Open in IMG/M
3300022200|Ga0196901_1158263All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage750Open in IMG/M
3300022407|Ga0181351_1003726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5582Open in IMG/M
3300022407|Ga0181351_1103384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1097Open in IMG/M
3300022407|Ga0181351_1177075Not Available738Open in IMG/M
3300024348|Ga0244776_10511933All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage773Open in IMG/M
3300024554|Ga0255242_1001209All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5522Open in IMG/M
3300025635|Ga0208147_1144656Not Available556Open in IMG/M
3300025732|Ga0208784_1041555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1434Open in IMG/M
3300027128|Ga0255099_1000604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14310Open in IMG/M
3300027154|Ga0255111_1076982All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage626Open in IMG/M
3300027213|Ga0208555_1073856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300027492|Ga0255093_1049000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage824Open in IMG/M
3300027494|Ga0255094_1002923All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6145Open in IMG/M
3300027578|Ga0255075_1074927Not Available594Open in IMG/M
3300027588|Ga0255101_1003431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3004Open in IMG/M
3300027675|Ga0209077_1140865Not Available673Open in IMG/M
3300027733|Ga0209297_1010187All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon4613Open in IMG/M
3300027733|Ga0209297_1194719All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage807Open in IMG/M
3300027759|Ga0209296_1159054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1007Open in IMG/M
3300027782|Ga0209500_10079271All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1671Open in IMG/M
3300027782|Ga0209500_10337756Not Available626Open in IMG/M
3300027793|Ga0209972_10359500All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300027798|Ga0209353_10289002Not Available697Open in IMG/M
3300027805|Ga0209229_10001035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium11392Open in IMG/M
3300027808|Ga0209354_10283638Not Available661Open in IMG/M
3300027816|Ga0209990_10473509All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300031566|Ga0307378_11134944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage625Open in IMG/M
3300031707|Ga0315291_10575378Not Available1027Open in IMG/M
3300031746|Ga0315293_11231085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300031758|Ga0315907_10104715All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2423Open in IMG/M
3300031758|Ga0315907_10998976Not Available604Open in IMG/M
3300031834|Ga0315290_10267473All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1494Open in IMG/M
3300031873|Ga0315297_11075177All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
3300031885|Ga0315285_10651492Not Available687Open in IMG/M
3300031951|Ga0315904_10178112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2115Open in IMG/M
3300031951|Ga0315904_11312770All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300031952|Ga0315294_11301285All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300031963|Ga0315901_10174477All Organisms → Viruses → Predicted Viral1889Open in IMG/M
3300031963|Ga0315901_10672590All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Alicycliphilus → Alicycliphilus denitrificans772Open in IMG/M
3300031997|Ga0315278_11207839All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage742Open in IMG/M
3300031997|Ga0315278_12010410All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300031999|Ga0315274_10901242All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage920Open in IMG/M
3300032053|Ga0315284_10130799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3325Open in IMG/M
3300032053|Ga0315284_10194640Not Available2628Open in IMG/M
3300032092|Ga0315905_10988261All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage709Open in IMG/M
3300032092|Ga0315905_11621356Not Available501Open in IMG/M
3300032118|Ga0315277_10726987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage950Open in IMG/M
3300032516|Ga0315273_10469756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1688Open in IMG/M
3300033816|Ga0334980_0288538Not Available639Open in IMG/M
3300033980|Ga0334981_0011369All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5050Open in IMG/M
3300033981|Ga0334982_0009973Not Available5652Open in IMG/M
3300033992|Ga0334992_0001369All Organisms → cellular organisms → Bacteria19340Open in IMG/M
3300034019|Ga0334998_0192100All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1275Open in IMG/M
3300034020|Ga0335002_0655663Not Available534Open in IMG/M
3300034021|Ga0335004_0190473All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1288Open in IMG/M
3300034022|Ga0335005_0223191All Organisms → Viruses → Predicted Viral1157Open in IMG/M
3300034061|Ga0334987_0240999Not Available1239Open in IMG/M
3300034061|Ga0334987_0508631All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage732Open in IMG/M
3300034061|Ga0334987_0679487All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage593Open in IMG/M
3300034062|Ga0334995_0057012Not Available3149Open in IMG/M
3300034063|Ga0335000_0660743Not Available579Open in IMG/M
3300034064|Ga0335001_0003091Not Available10006Open in IMG/M
3300034068|Ga0334990_0546030Not Available613Open in IMG/M
3300034082|Ga0335020_0005121Not Available8416Open in IMG/M
3300034101|Ga0335027_0856176Not Available521Open in IMG/M
3300034102|Ga0335029_0425037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage794Open in IMG/M
3300034105|Ga0335035_0059881All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2499Open in IMG/M
3300034106|Ga0335036_0130307Not Available1812Open in IMG/M
3300034116|Ga0335068_0496350Not Available566Open in IMG/M
3300034117|Ga0335033_0351389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage740Open in IMG/M
3300034118|Ga0335053_0674197Not Available585Open in IMG/M
3300034120|Ga0335056_0346096Not Available812Open in IMG/M
3300034120|Ga0335056_0643855All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300034168|Ga0335061_0547546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300034200|Ga0335065_0038533All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3352Open in IMG/M
3300034272|Ga0335049_0427657Not Available861Open in IMG/M
3300034280|Ga0334997_0746856Not Available592Open in IMG/M
3300034284|Ga0335013_0154245All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1559Open in IMG/M
3300034356|Ga0335048_0461582Not Available616Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater18.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake16.11%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine10.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment8.33%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.67%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.11%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater4.44%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater3.89%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.78%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.22%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.22%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.67%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.67%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.67%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.11%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.11%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.11%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.11%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand1.11%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.56%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.56%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.56%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.56%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.56%
Freshwater And MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine0.56%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.56%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.56%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.56%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.56%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000792Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21mEnvironmentalOpen in IMG/M
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300000883Estuary microbial communities from the Columbia River - 5 PSUEnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300004796Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005739Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005992Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14EnvironmentalOpen in IMG/M
3300006007Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_23-Sept-14EnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007562Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02EnvironmentalOpen in IMG/M
3300007649Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3EnvironmentalOpen in IMG/M
3300007651Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008459Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigsEnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009051Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02EnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009807Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10EnvironmentalOpen in IMG/M
3300009819Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300011995Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012708Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020556Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021091Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40mEnvironmentalOpen in IMG/M
3300021312Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021317Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021325Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021600Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11mEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024554Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027128Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8dEnvironmentalOpen in IMG/M
3300027154Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300027213Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027492Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8dEnvironmentalOpen in IMG/M
3300027494Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8dEnvironmentalOpen in IMG/M
3300027578Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8hEnvironmentalOpen in IMG/M
3300027588Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8dEnvironmentalOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034168Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BS_KBA_SWE02_21mDRAFT_1012628233300000792MarinePSGDPVMLAKPTRASVYGFDKDKKLVGPSTVTLPAGWYVLPKSQ*
FwDRAFT_1004173543300000882Freshwater And MarineVPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKN*
EsDRAFT_1011956213300000883Freshwater And MarineLVPNGDPVMLAEPTKASVYSFDSNKKLVGPSRVVLPAGWYVLPKQ*
NpDRAFT_1028029013300000929Freshwater And MarineGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKN*
Ga0007763_1082790913300004796Freshwater LakePVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK*
Ga0068876_1064561223300005527Freshwater LakeMVPNGDPVMLAAPTKASVYSFDKDKKLVGPATVVIPAGWYALPKSK*
Ga0076948_105497413300005739Lake WaterAKPTKAKVYAFDKDQKLVGPSTVTLPAGWYALPKTK*
Ga0079957_130166743300005805LakeVVLVPSGDPVMLAKPTRASVYGFDSNKKLVGPSTVVLPAGWYALPKN*
Ga0079957_131545013300005805LakeAKPVKASVYAFDKDKKLVGPSTVKLPAGWYVLPKQ*
Ga0073924_105608823300005992SandMLVLPIFPACQTTVVMVPNGDPVMLAKPTKASVYSFDKNQKLVGPATVVIPAGWYALPKSK*
Ga0073917_101663823300006007SandMLAEPVRARVYAFDKDKKLVGPSKVVLPAGWYVLPKN*
Ga0075461_1022926423300006637AqueousGDPVMLAKPTKAKVYAFDKDQKLVGPSTVTLPAGWYALPKTK*
Ga0075461_1025180533300006637AqueousVVLVPSGDPVMLAKPTKASVYSFDSNKKLVGPSTVVIPAGWYALPK*
Ga0075472_1005485213300006917AqueousMVPHGDPVMLAKPVKASVYAFDANKKLVGPSTVVIPAGWYALPK*
Ga0075472_1021980533300006917AqueousAKPTKASVYSFDSNKKLVGPSTVVIPAGWYALPK*
Ga0075458_1004475313300007363AqueousLPICLGCQQTKVVMVPHGDPVMIAAPVQASVYGFDKNKKLVGPSKVTLPAGWYVLPKQ*
Ga0075458_1015922623300007363AqueousMLAKPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK*
Ga0099851_112716513300007538AqueousLAKPTKASVYSFDKNQKLVGPSTVIIPAGWYALPK*
Ga0099848_127119723300007541AqueousMLAKPTKASVYSFDSNKKLVGPSTVVIPAGWYALPK*
Ga0102861_109308923300007544EstuarineMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK*
Ga0102820_112158113300007554EstuarineCLGCQVTKVVLVPSGDPVMLAKPVKASVYSFDKNKKLVGPATVVIPAGWYALPKSK*
Ga0102828_108053713300007559EstuarineGDPVMLAKPVQASVYAFDADKKLVGPSRVTLPAGWYVLPKK*
Ga0102915_124917013300007562EstuarineKPVKASVYSFDANKKLVGPATVVIPAGWYALPKSK*
Ga0102912_114753233300007649EstuarineLALPIFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK
Ga0102900_109138313300007651EstuarineGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK*
Ga0102859_103383013300007708EstuarineLGCQMTKVVLVPSGDPVMLAEPVKASVYGFDKDQKLVGPSRVTLPAGWYVLPKK*
Ga0102859_121848113300007708EstuarineLVPSGDPVMLAKPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKN*
Ga0102859_122164923300007708EstuarineVPSGDPVMLAKPTTASVYAFDADKKLVGPSNVVLPAGWYVLPKN*
Ga0105749_109640513300007864Estuary WaterRVVLVPSGDPVMLAQPVKASVYGFDSDKKLVGPSNVVLPAGWYVLPKSQ*
Ga0105745_108796443300007972Estuary WaterVPSGDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK*
Ga0105746_100594013300007973Estuary WaterQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKQ*
Ga0108970_1125810633300008055EstuaryMLAKPVKASVYSFDANKKLVGPSTVVIPAGWYALPKSK*
Ga0114340_114111913300008107Freshwater, PlanktonAKPTKASVYSFDKNQKLVGPSTVILPAGWYALPK*
Ga0114363_117639853300008266Freshwater, PlanktonMLAKPVKASVYSFDKNKKLVGPATVVIPAGWYALPKS
Ga0114363_121074913300008266Freshwater, PlanktonMVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKS
Ga0114363_123106813300008266Freshwater, PlanktonMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKS
Ga0114364_115574913300008267Freshwater, PlanktonIALLTCLGCQVTKVALVPSGDPVMLAKPVKASVYSFDKNKKLVGPATVVIPAGWYALPKSK*
Ga0114865_111867833300008459Freshwater LakeIALLTCLGCQVTKVALVPSGDPVMLAKPVKASVYSFDKDKKLVGPATVVIPAGWYALPKSK*
Ga0102811_123919223300009024EstuarineMLAKPVKASVYSFDKNKKLVGPATVVIPAGWYALPKSK*
Ga0102829_107398213300009026EstuarineQPVKASVYGFDKDKKLVGPSKVVLPAGWYVLPKN*
Ga0102864_120253123300009051EstuarineMLAKPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKQ*
Ga0102860_111301943300009056EstuarineMVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK*
Ga0114980_1002309663300009152Freshwater LakeVPSGDPVMLAQPTTASVYGFDSDKKLVGPSKVTLPAGWYVLPKN*
Ga0114980_1027425023300009152Freshwater LakeMTKVVLVPSGDPVMLARPTTASVYGFDKDKKLVGPSTVTLPAGWYVLPKSQ*
Ga0114977_1004826963300009158Freshwater LakeAQPVKASVYAFDADKKLVGPSRVTLPAGWYVLPKK*
Ga0114977_1065750813300009158Freshwater LakeMTKVVLVPSGDPVMLAQPVKASVYAFDADKKLVGPSRVTLPAG
Ga0114978_1026521133300009159Freshwater LakeVPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVTLPAGWYVLPKN*
Ga0105102_1074149213300009165Freshwater SedimentPNGDPVMLAEPIRARVYAFDKDGKLSGPDRVTLPAGWYVLPKTK*
Ga0105104_1006901513300009168Freshwater SedimentLVPSGDPVMLAKPVKASVYGFDSNKKLVGPSTVTLPAGWYVLPKQ*
Ga0114974_1065006123300009183Freshwater LakeAEPVRARVYAFDKDKKLVGPSRVVLPAGWYVLPKN*
Ga0105061_104231113300009807Groundwater SandKVVLVPSGDPVMLAKPTKASVYGFDSDKKLVGPSRVVLPAGWYVLPKN*
Ga0105087_105165223300009819Groundwater SandKPTTASVYGFDADKKLVGPSKVVLPAGWYVLPKN*
Ga0129333_1053442633300010354Freshwater To Marine Saline GradientSGDPVMLAKPTKASVYSFDKNQKLVGPSTVIIPAGWYALPK*
Ga0129333_1055317413300010354Freshwater To Marine Saline GradientKVVLVPSGDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK*
Ga0129333_1059409723300010354Freshwater To Marine Saline GradientMVPHGDPVMLAKPVKASVYAFDKDKRLVGPSRVTLPSGWYVLPKD*
Ga0133913_1209362013300010885Freshwater LakeGDPVMLAQPVKASVYAFDADKKLVGPSRVTLPAGWYVLPKK*
Ga0151620_109928513300011268FreshwaterMLAKPVKASVYAFDKDKKLVGPSRVELPAGWYVLPKSQ*
Ga0153800_103562413300011995FreshwaterTKVVLVPSGDPVMLAKPVQASVYGFDSDKKLVGPSKVILPAGWYVLPKSQ*
Ga0153805_107764233300012013Surface IceGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKQ*
Ga0157595_104916033300012708FreshwaterVMLAKPVKASVYGFDKDKKLVGPSTVTLPAGWYALPK*
(restricted) Ga0172367_1061552823300013126FreshwaterMTKVVLVPSGDPVMLAEPTRARVYAFDRDGKLVGPSTVKIPAGWYALPKAK*
(restricted) Ga0172366_1051471013300013128SedimentLVPSGDPVMLAKPVKASVYGFDKDKKLVGPSTVVLPAGWYVLPKE*
(restricted) Ga0172373_1062380913300013131FreshwaterMLAKPIKASVYGFDRDKKLVGPSNVTLPAGWYVLPKD*
(restricted) Ga0172362_1004642563300013133SedimentMLAKPIKASVYGFDRDKKLVGPSTVKIPAGWYALPKTK*
Ga0177922_1084136023300013372FreshwaterCQMTKVVLVPSGDPVMLAKPVKASVYGFDKDKKLVGPSTVVLPAGWYALPKN*
Ga0181363_106483613300017707Freshwater LakeMLAKPVKASVYAFDANKKLVGPSKVTLPAGWYVLPKN
Ga0181365_116003713300017736Freshwater LakePSGDPVMLAKPATASVYGFDSDKKLVGPSKVVLPAGWYVLPKQ
Ga0181365_116412213300017736Freshwater LakeVVLVPSGDPVMLAQPVKASVYAFDADKKLVGPSRVTLPA
Ga0181352_113242113300017747Freshwater LakeQVTKVALVPSGDPVMLAKPVKASVYGFDKDKKLVGPATVVIPAGWYALPKSK
Ga0181352_118230813300017747Freshwater LakeMTKVVLVPSGDPVMLAKPVKASVYGFDSNKKLVGPSTVTLPAGWYALPKN
Ga0181344_102123253300017754Freshwater LakePICLGCRTKVVLVPSGDPVLLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK
Ga0181344_111910613300017754Freshwater LakeLGCQMTKVVLVPSGDPVMLAKPTKASVYGFDKDKKLVGPSNVTLPAGWYVLPKN
Ga0181344_113019923300017754Freshwater LakeMLALPTFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKDKKLVGPATVVIPAGWYALPKS
Ga0181358_105136733300017774Freshwater LakeRVVLVPSGDPVMLAKPTTASVYGFDKDKKLVGPSKVVLPAGWYVLPKN
Ga0181358_108954723300017774Freshwater LakeVLPICLGCQMTRVVLVPSGDPVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKR
Ga0181357_115990923300017777Freshwater LakeVPSGDPVMLAQPVKASVYSFDSNKKLVGPSKVVLPAGWYVLPKQ
Ga0181357_118378643300017777Freshwater LakeCLGCQVTRVVLVPSGDPVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKR
Ga0181346_113014533300017780Freshwater LakeVLVPSGDPVMLALPVKASVYGFDSDKKLGGRSRVNLPAGWYVLTKK
Ga0181346_116955913300017780Freshwater LakeALPIFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK
Ga0181346_129370213300017780Freshwater LakeVLPICLGCQMTKVVLVPSGDPVMLAEPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKQ
Ga0181348_123157143300017784Freshwater LakeCLGCQVTRVVLVPSGDPVMLAQPVKASVYGFDADKKLVGPSKVVLPAGWYVLPKQ
Ga0181348_131971433300017784Freshwater LakePICLGCQVTRVVLVPSGDPVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKR
Ga0181355_112387513300017785Freshwater LakeTKVVLVPSGDPVMLAKPTKAKVYAFDKDQKLVGPSTVTLPAGWYALPKTK
Ga0181563_1039372613300018420Salt MarshPVMLAQPVKASIYSFDKNKKLVGPSTVIIPAGWYALPK
Ga0181359_122748513300019784Freshwater LakeGCLGCQQTKVVMVPHGDPVMLAKPTKASVYSFDSNKKLVGPSTVVIPAGWYALPK
Ga0181556_109306663300020176Salt MarshMLAQPVKASIYSFDKNKKLVGPSTVIIPAGWYALPK
Ga0194115_1008435713300020183Freshwater LakeLALPICLGCQMTKVVLVPHGDPVMLAKPVTASVYGFDRDKKLVGPSNVTLPAGWYVLPKE
Ga0194124_1010305513300020196Freshwater LakeLVPHGDPVMLAKPVTASVYGFDKDKKLVGPSNVTLPAGWYVLPKE
Ga0211731_1140330513300020205FreshwaterQQTKVVLVPSGDPVMLAKPLKASVYGFDKDKKLVGPSTVTLPAGWYVLPKN
Ga0208486_102290033300020556FreshwaterPVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKSQ
Ga0194133_1050247313300021091Freshwater LakeGCQMTRVVLVPHGDPVMLAKPVTASVYGFDRDKKLVGPSNVTLPAGWYVLPKE
Ga0210306_114268323300021312EstuarineCQQTKVVLVPSGDPVMLAEPVKASVYGFDKDKKLVGPSKVVLPAGWYVLPKN
Ga0210309_112301123300021317EstuarineVLPICLGCQQTKVILVPNGDPVMLARPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKN
Ga0210301_134964523300021325EstuarineMAALLTCLGCQMTRVVLVPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPK
Ga0194059_119743023300021600Anoxic Zone FreshwaterPVMLAEPVRARVYAFDKDGKLSGPSRVTLPAGWYVLPKAK
Ga0194059_121466233300021600Anoxic Zone FreshwaterMLAEPVRARVYAFDKDGKLSGPSRVTLPAGWYVLP
Ga0222714_1034270223300021961Estuarine WaterMLALPIFPACQTTVVMVPNGDPVMLAKPVKASVYGFDKDKKLVGPATVVIPAGWYALPKS
Ga0222712_1030390413300021963Estuarine WaterLAQPVKASVYGFDSEKKLVGPSKVVLPAGWYVLPKN
Ga0222712_1032265833300021963Estuarine WaterVVLVPSGDPVMLAKPIKASVYAFDADKKLVGPSRVTLPAGWYVLPKK
Ga0222712_1047642323300021963Estuarine WaterMLAKPVKASVYSFDANKKLVGPATVVIPAGWYALPKSK
Ga0181353_113213413300022179Freshwater LakeRTKVVLVPSGDPIMLSEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKTK
Ga0196901_115826333300022200AqueousVMLAKPTKASVYSFDSNKKLVGPSTVVIPAGWYALPK
Ga0181351_100372643300022407Freshwater LakeMLALPIFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKS
Ga0181351_110338463300022407Freshwater LakeMLAKPTTASVYGFDKDKKLVGPSKVVLPAGWYVLPKN
Ga0181351_117707543300022407Freshwater LakeVILVPNGDPVMLAEPVRARVYAFDKDKKLVGPSKVVLPAGWYVLPKQ
Ga0244776_1051193333300024348EstuarineMVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK
Ga0255242_100120933300024554FreshwaterVVLVPSGDPIMLAEPVRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK
Ga0208147_114465613300025635AqueousLIALPICLGCQTKVVMVPHGDPVMLAKPVKASVYAFDANKKLVGPSTVVIPAGWYALPK
Ga0208784_104155543300025732AqueousVPSGDPVMLAKPIKASVYAFDSNKKLVGPSRVELPAGWYVLPKSQ
Ga0255099_1000604103300027128FreshwaterPVMLAKPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK
Ga0255111_107698233300027154FreshwaterPVMLAKPTKASVYSFDSNKKLVGPSTVVIPAGWYALPK
Ga0208555_107385623300027213EstuarineMLAFPIFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKS
Ga0255093_104900013300027492FreshwaterVVLVPSGDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPK
Ga0255094_100292313300027494FreshwaterLPIFPACQTTVVMVPNGDPVMLAKPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK
Ga0255075_107492713300027578FreshwaterALLTCLGCQVTKVALVPSGDPVMLAAPTKASVYSFDANKKLVGPATVVIPAGWYALPKSK
Ga0255101_100343113300027588FreshwaterPNGDPVMLAKPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK
Ga0209077_114086513300027675Freshwater SedimentKVILVPSGDPVMLAEPVRARVYAFDKDGKLSGPDKVTLPAGWYVLPKTK
Ga0209297_101018773300027733Freshwater LakeVPSGDPVMLAQPTTASVYGFDSDKKLVGPSKVTLPAGWYVLPKN
Ga0209297_119471933300027733Freshwater LakeGCQMTKVVLVPSGDPVMLAQPVKASVYAFDADKKLVGPSRVTIPAGWYVLPKK
Ga0209296_115905413300027759Freshwater LakeMTKVVLVPSGDPVMLAQPVKASVYAFDADKKLVGPSKVVLPAG
Ga0209500_1007927133300027782Freshwater LakeVPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVTLPAGWYVLPKN
Ga0209500_1033775613300027782Freshwater LakeDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKTK
Ga0209972_1035950033300027793Freshwater LakeVVLVPNGDPVMLARPTKASVYGFDKDKKLVGPSTVILPAGWYALPK
Ga0209353_1028900213300027798Freshwater LakeKVILVPNGDPVMLAEPVRARVYAFDKDKKLVGPSKVVLPAGWYVLPKQ
Ga0209229_1000103513300027805Freshwater And SedimentKVVLVPSGDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK
Ga0209354_1028363843300027808Freshwater LakeLAVLPICLGCQVTRVVLVPSGDPVMLAEPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPK
Ga0209990_1047350923300027816Freshwater LakeMLALPIFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKDKKLVGPATVVIPAGWYALPKS
Ga0307378_1113494413300031566SoilMLALPIFPACQTTVVMVPNGDPVMLAKPTKASVYSFDKNQKLVGPATVVIPAGWYALPKQ
Ga0315291_1057537833300031707SedimentTCLGCQMTKVVLVPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKQ
Ga0315293_1123108523300031746SedimentALLTCLGCQVTRVVLVPSGDPVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKN
Ga0315907_1010471543300031758FreshwaterLVPNGDPVMLARPTKASVYGFDKDKKLVGPSTVILPAGWYALPK
Ga0315907_1099897633300031758FreshwaterVPSGDPVMLAKPVKASVYGFDKDKKLVGPSTVVLPAGWYVLPKSQ
Ga0315290_1026747313300031834SedimentAEPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKN
Ga0315297_1107517713300031873SedimentSGDPVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKSQ
Ga0315285_1065149213300031885SedimentGCQMTKVVLVPSGDPVMLARPTKASVYSFDSNKKLVGPSRVVLPAGWYVLPKQ
Ga0315904_1017811243300031951FreshwaterTASLGCRTTVVLVPSGDPVMLAKPTKASVYSFDKNQKLVGPSTVIIPAGWYALPK
Ga0315904_1131277023300031951FreshwaterQMTKVVLVPSGDPVMLAKPTKASVYGFDKDKKLVGPSTVVLPAGWYALPKN
Ga0315294_1130128513300031952SedimentMTKVVLVPSGDPVMLAKPVQASVYAFDADKKLVGPSRVTLPAGWYVLP
Ga0315901_1017447723300031963FreshwaterMLAAPTKASVYSFDKDKKLVGPATVVIPAGWYALPKSK
Ga0315901_1067259013300031963FreshwaterKVVLVPNGDPVMLAKPTKASVYGFDKDKKLVGPSTVTLPAGWYALPK
Ga0315278_1120783933300031997SedimentPSGDPVMLAQPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKSQ
Ga0315278_1201041013300031997SedimentMLVLPICLGCQMTKVVLVPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPK
Ga0315274_1090124213300031999SedimentGCQVTRVVLVPSGDPVMLAEPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKSQ
Ga0315284_1013079913300032053SedimentLPICLGCQVTRVVMVPSGDPVMLAQPVKASVYGFDSDKKLVGPSRVVLPAGWYVLPKSQ
Ga0315284_1019464023300032053SedimentMLAESVRARVYAFDKDGKLSGPSRVTLPAGWYVLPKAK
Ga0315905_1098826123300032092FreshwaterDCLGCQMTKVVLVPSGDPVMLAAPVKARVYAFDKDKKLVGPSTVVLPAGWYALPKN
Ga0315905_1162135613300032092FreshwaterALPICLGCQQTKVVMVPHGDPVMIAAPVQASVYGFDKDKKLVGPSKVTLPAGWYVLPKQ
Ga0315277_1072698733300032118SedimentEPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKSQ
Ga0315273_1046975613300032516SedimentMLVLPICLGCQMTKVVLVPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKSQ
Ga0334980_0288538_494_6373300033816FreshwaterVLVPSGDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYVLPKTK
Ga0334981_0011369_4911_50213300033980FreshwaterMLAKPVKASVYGFDSNKKLVGPSTVTLPAGWYALPK
Ga0334982_0009973_5524_56343300033981FreshwaterMLAKPTKASVYSFDKNQKLVGPSTVIIPAGWYALPK
Ga0334992_0001369_18653_187873300033992FreshwaterMVPHGEPVMLAKPVKASVYAFDQDKKLVGPSKVTLPAGWYVLPK
Ga0334998_0192100_1162_12753300034019FreshwaterMLAKPTRASVYGFDSNKKLVGPSTVVLPAGWYALPKN
Ga0335002_0655663_8_1213300034020FreshwaterMLAKPVKASVYGFDSNKKLVGPSTVTLPAGWYVLPKQ
Ga0335004_0190473_825_10043300034021FreshwaterMLTCLGCQVTKVVLVPSGDPVMLAKPTRASVYGFDKDKKLVGPSTVVIPAGWYALPKSK
Ga0335005_0223191_1035_11573300034022FreshwaterPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKSK
Ga0334987_0240999_1114_12393300034061FreshwaterDPVMLAEPVRARVYAFDKDGKLSGPDKVTLPAGWYALPKTK
Ga0334987_0508631_531_6833300034061FreshwaterMTKVVLVPSGDPVMLAKPVKASVYGFDKDKKLVGPSTVTLPAGWYVLPKQ
Ga0334987_0679487_22_1383300034061FreshwaterMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK
Ga0334995_0057012_180_2963300034062FreshwaterMLAEPVRARVYAFDKDGKLSGPSRVTLPAGWYVLPKAK
Ga0335000_0660743_2_1273300034063FreshwaterDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK
Ga0335001_0003091_9856_99693300034064FreshwaterMLAQPVKASVYAFDADKKLVGPSRVTLPAGWYVLPKK
Ga0334990_0546030_1_1173300034068FreshwaterMLAEPVRARVYAFDKDGKLSGPSRVILPAGWYVLPKAK
Ga0335020_0005121_4125_42383300034082FreshwaterMLAKPVKASVYAFDADKKLVGPSRVTLPAGWYVLPKK
Ga0335027_0856176_409_5193300034101FreshwaterAKPTKASVYGFDKDQKLVGPSTVTLPAGWYALPKTK
Ga0335029_0425037_2_1363300034102FreshwaterVPSGDPVMLAKPTTASVYGFDSDKKLVGPSKVVLPAGWYVLPKN
Ga0335035_0059881_1229_14113300034105FreshwaterMLALPIFPACQTTVVMVPNGDPVMLAAPTKASVYSFDKNKKLVGPATVVIPAGWYALPKQ
Ga0335036_0130307_2_1543300034106FreshwaterMTRVVLVPSGDPVMLAKPTTASVYAFDADKKLVGPSRVTLPAGWYVLPKK
Ga0335068_0496350_26_1783300034116FreshwaterMTKVVLVPSGDPVMLAKPTRASVYGFDSDKKLVGPSTVTLPAGWYALPKQ
Ga0335033_0351389_578_7213300034117FreshwaterVVLVPSGDPVMLAQPVKASVYGFDKDKKLVGPSKVVLPAGWYVLPKN
Ga0335053_0674197_6_1583300034118FreshwaterVTRVVLVPSGDPVMLAQPVKASVYAFDADKKLVGPSRVTLPAGWYVLPKK
Ga0335056_0346096_4_1563300034120FreshwaterVTKVVLVPSGDPVMLAKPVKASVYGFDKDKKLVGPSKVTLPAGWYALPKN
Ga0335056_0643855_416_5293300034120FreshwaterMLAKPVKASVYGFDKDKKLVGPSTVTLPAGWYVLPKN
Ga0335061_0547546_406_5583300034168FreshwaterMTKVVLVPSGDPVMLAEPVKASVYGFDSDKKLVGPSKVVLPAGWYVLPKN
Ga0335065_0038533_2099_22153300034200FreshwaterMLAKPTKASVYSFDKNQKLVGPATVVIPAGWYALPKSK
Ga0335049_0427657_2_1663300034272FreshwaterLGCQQTKVVLVPSGDPVMLAKPVQASVYAFDADKKLVGPSRVTLPAGWYVLPKK
Ga0334997_0746856_459_5903300034280FreshwaterSGDPIMLAEPTRASVYAFDRDGKLVGPSTVKIPAGWYALPKAK
Ga0335013_0154245_1447_15573300034284FreshwaterLAKPTRASVYGFDSNKKLVGPSTVTLPAGWYALPKN
Ga0335048_0461582_3_1463300034356FreshwaterVLVPSGDPVMLAKPVKASVYGFDSNKKLVGPSTVTLPAGWYVLPKSQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.