


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000607 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053179 | Ga0027972 |
| Sample Name | Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765337473 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 21380566 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella disiens | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077404 | Metagenome | 117 | N |
| F094006 | Metagenome | 106 | Y |
| F099454 | Metagenome | 103 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C815428 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae | 743 | Open in IMG/M |
| SRS019329_WUGC_scaffold_10325 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 2505 | Open in IMG/M |
| SRS019329_WUGC_scaffold_1147 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella disiens | 730 | Open in IMG/M |
| SRS019329_WUGC_scaffold_9789 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas | 1950 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C815428 | C815428__gene_32439 | F094006 | AAMRGTLEPTGPTGALYESTVCVEAHIGYLQAGSIARLGLFAFGGRHLLAVAEFGAEAPHAIDMYDIAVCEPLSKLFAEELEYAFNFGA |
| SRS019329_WUGC_scaffold_10325 | SRS019329_WUGC_scaffold_10325__gene_10146 | F077404 | MNILKTVFAFFFALCFMMGANSYAQKTECINAEASKRELKRNAVYLPPALEEYADTILLHQRFNVENKGNYLYTPFTKDNEPSIPFNYGFLHPLGERFYNCFMGKVDRILRPKEDKGFIILTNYLVVLDDKYAFDTSNKDTSKLADLKYLDFRRIKSDFSYGHPYQGFTDYDRVELSYFESYGRQAALETANTWVMASYPFSLQSTKFENLYTRGRKLILTDGKTTLSLYFLMIDSVALNFDTKVLPYIKGVFRFNRIR |
| SRS019329_WUGC_scaffold_1147 | SRS019329_WUGC_scaffold_1147__gene_564 | F099454 | MKASKLLWAVVVALTFVLTSCDRVTDEPTIEGKINKFFDSQAQRKSFRVLTASGKPYNHKIDWHIIGILDPKSENYLTKKIDTLSNGDLKISYDWVAFIVRENKSVIDVEVQKNETGQDRSVDFVAQDNHKGLASPSMTVIQRAK |
| SRS019329_WUGC_scaffold_9789 | SRS019329_WUGC_scaffold_9789__gene_9215 | F099454 | MKASKLLWAVVMPLTFVLTSCDRLTDEPTLEDRGYKYFDSTAQQKSFRVVTASGKPYNHKIDWHIIGILDSKSDTYLTKKVDTLSNGDLRISYDWVAFTVRENKSVIDVEVQKNETGQDRSVKFVAKDDHKGLASPSMKVIQQAK |
| ⦗Top⦘ |