


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 7000000255 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052773 | Ga0031225 |
| Sample Name | Human throat microbial communities from NIH, USA - visit 2, subject 765560005 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 35580322 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae | 2 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045567 | Metagenome | 152 | N |
| F047508 | Metagenome | 149 | N |
| F053092 | Metagenome | 141 | N |
| F072446 | Metagenome | 121 | N |
| F098763 | Metagenome | 103 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C938563 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae | 613 | Open in IMG/M |
| C947099 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| C947553 | Not Available | 801 | Open in IMG/M |
| C948409 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae | 827 | Open in IMG/M |
| SRS065335_LANL_scaffold_5343 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas | 559 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C938563 | C938563__gene_66483 | F053092 | EMENTMDDHTVQLFGILIAKELGIATHRIKADEHVPRDHIPLTLVEGDDIGIVVMIEEVLIGLQDALITTELVAELADTTVIASSDLTDPVAKDTLSEARLLDVFVSIVSYKLRFFRHK |
| C947099 | C947099__gene_68948 | F047508 | EAIATDAVFVIEFVGEPIHIGMLRHRLVEGRIKYPYLRRIWEYLRHSFDTEDVGWVVKRSELCALMEHIYYLWGDTYALSKALCTVYEAVTDGVDLIEGLYEVLFFENVEDNLYAACVVRNVKVALDLLSFGVTEGDEGVVDPYALFVPRGQDLVVGELDEGELQGGAATVEDQDFHKVLYYMVRCELILSSP |
| C947553 | C947553__gene_69094 | F072446 | HEPTKPVRPFHGDTLAQIAWNFRFIVENHYHSIPGIVPEGTTYRVPVIPRSVEDKTEKEYNDMELGKEAHLVFRATVHGDTINRHKKELKALSLQLNRLTETSIGTSPVLCGVKSIEAVGIAENGNTYDLRGEMKLRIRDYSYRLKYPSGIITLDCENTESLTAKYVVPLGRIREYELAEHIQPELKFYLPVKRCMDFSSIRFAITLFNGEVLSFQHKLPSKSVLQELPNKSVLENYQQYGFIPESTYFTTLWPLPDYKYNEREL |
| C948409 | C948409__gene_69379 | F045567 | DGDILTPRDGTHIVQTERVVVVLVSQEDSIDTIDTETCGLVVEVRATVDEDTLPTLGDDEGRGAQTTVTSIRAMAHWAATAYLGDTSAGARTEKNYLHVSRRESYHGKEIPSLSSERGCVVERVVR |
| SRS065335_LANL_scaffold_5343 | SRS065335_LANL_scaffold_5343__gene_6582 | F098763 | MDRRTSLRILSTVLYLATKLFKAVVRTTISYDSSDEVEGKGGMNAIPTAVDE |
| ⦗Top⦘ |