NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300033173

3300033173: Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_8_08-R1



Overview

Basic Information
IMG/M Taxon OID3300033173 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0136119 | Gp0356205 | Ga0334889
Sample NameSludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_8_08-R1
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size533876655
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. SDB1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Candidatus Methanofastidiosa → Candidatus Methanofastidiosum → Candidatus Methanofastidiosum methylthiophilus1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1
Not Available4

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands
TypeEngineered
TaxonomyEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationNetherlands: Wageningen, Gelderland
CoordinatesLat. (o)51.9691Long. (o)5.6654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005744Metagenome / Metatranscriptome391Y
F048390Metagenome / Metatranscriptome148Y
F054061Metagenome / Metatranscriptome140Y
F070092Metagenome123N
F077264Metagenome / Metatranscriptome117Y
F080090Metagenome / Metatranscriptome115Y
F089495Metagenome / Metatranscriptome109N
F098758Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0334889_1009425All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii6627Open in IMG/M
Ga0334889_1041684All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon1876Open in IMG/M
Ga0334889_1054447All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. SDB1501Open in IMG/M
Ga0334889_1076059All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Candidatus Methanofastidiosa → Candidatus Methanofastidiosum → Candidatus Methanofastidiosum methylthiophilus1140Open in IMG/M
Ga0334889_1109453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes848Open in IMG/M
Ga0334889_1137018Not Available705Open in IMG/M
Ga0334889_1138134Not Available701Open in IMG/M
Ga0334889_1141266Not Available688Open in IMG/M
Ga0334889_1163795Not Available609Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0334889_1009425Ga0334889_10094257F080090MQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQ
Ga0334889_1041684Ga0334889_10416841F054061MDEMFEIIKAGAPDGPPEQALYRIQQTYPDGSGGRLNVDWDGLRRLHGLIHDRIALEGYACETCDTKGCHRPA
Ga0334889_1054447Ga0334889_10544472F048390MVYLKYTGLLQYCMVRFVRTLQHRITKQGRDFYQLSIPPQVAEALNLKDGGPVSIRVQPIKRGEVQIILAAADSEV
Ga0334889_1076059Ga0334889_10760592F098758MDKIRARNVGIIILISVLILFSGCSKPKEEPPPIITDPCENVECPDVCKGNDLWSQKCVDGECVDFVRIEPCSENCGCVVDLCQRIKCNDQCRSEDLWAYKCVNGICTPESIKETCAIECGCAPKFFYKLVPLARYRLREVGIIANVYSIRSDQLIRAVVTCRTSLCTDPPTVYYTKFDDPFERSEDETVDYFGPLWKN
Ga0334889_1109453Ga0334889_11094532F089495GTTPYTLDITGYSDIPELPEPVIDVAAEPYVVGGNFNSIEEGDDAVTLPEFAITIDINDADVATGKYAIDQWFANHKEGTGTTALVTTNDGSAYLKKSIDGTTTSANLSTDYFTIGLKVLFDNGGTGKAFGKDFKYIRPIDAKFSTSGKAQVTIRGQILGAPTDITAL
Ga0334889_1137018Ga0334889_11370181F005744MDEMFEIIKAGAPNGPPEQALYRIQQTYSDGSGGRLNVDWDGLLRLHEVIHDRIALEGRVCETCGTKGCHRPATWEIECRGAGVASCLIYSCDDHCPDPAILSPQDEIRRLVEE
Ga0334889_1138134Ga0334889_11381341F070092TNRQKIDLMISHGMASDLAIERRKKELYDEVMTAKENAFKEELAELEGEIKKIEYSYHEPKKDPTTKLLEFEQIKAKIRSTPSKELKELTHTFQNTGAIPGIPWERPDHVDVLVAELRNRGLDEEADLTWDYAYNKLKVDRPWENNPLYKQLKAQHNKVSVLAGFKDMLKYLDGTNNAVYISETLKYKG
Ga0334889_1141266Ga0334889_11412661F077264MALKLIWNLRADSAWIELVKVQAIETGRSSPGAFVRDLVWTLSKNPTIKNRIFEA
Ga0334889_1163795Ga0334889_11637951F070092MAINDRLKPVMELLETNRQKIGLMISHGMASDLAIERRKKELYDEVMTAKENAFKEELADLEGEIRKIEYSYREPKKDPTTKLLEFEQIKAKIRSTPSKELKELTHTFQTTGAIPGIPWERPDHVDVLVAELRNRGLNEEADLTWDYAYNKLKVDRPWENNPLYKQLKAQHNKVSVLAGFKDMLKYLDGTNNA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.