| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029818 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133313 | Gp0288070 | Ga0246095 |
| Sample Name | Groundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig2699 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of California, Berkeley |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 148821655 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Candidatus Methanoperedenaceae → Candidatus Methanoperedens → Candidatus Methanoperedens nitroreducens | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater biome → planetary subsurface zone → groundwater |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Japan: Horonobe URL | |||||||
| Coordinates | Lat. (o) | 45.045278 | Long. (o) | 141.859444 | Alt. (m) | N/A | Depth (m) | 215 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F072481 | Metagenome / Metatranscriptome | 121 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0246095_102133 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Candidatus Methanoperedenaceae → Candidatus Methanoperedens → Candidatus Methanoperedens nitroreducens | 9850 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0246095_102133 | Ga0246095_10213311 | F072481 | MLLRLKSNLFGIMIPGSKQSEDMKSRKEGTIPPFHPNLKSEKHVSCKHCGETYKENEIKRDPKSGEWVCKHYPKCEGTGWHSI |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |