| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029790 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133095 | Gp0281941 | Ga0242825 |
| Sample Name | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 015_6_4_stool_1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 263753077 |
| Sequencing Scaffolds | 8 |
| Novel Protein Genes | 9 |
| Associated Families | 8 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia wexlerae | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Baltimore | |||||||
| Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042936 | Metagenome | 157 | N |
| F056309 | Metagenome | 137 | N |
| F059106 | Metagenome | 134 | N |
| F071325 | Metagenome | 122 | N |
| F076190 | Metagenome | 118 | Y |
| F078004 | Metagenome | 117 | N |
| F078822 | Metagenome | 116 | N |
| F089005 | Metagenome | 109 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0242825_1000190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 133067 | Open in IMG/M |
| Ga0242825_1001326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 30373 | Open in IMG/M |
| Ga0242825_1001691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia wexlerae | 23891 | Open in IMG/M |
| Ga0242825_1001710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 23593 | Open in IMG/M |
| Ga0242825_1002112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 19289 | Open in IMG/M |
| Ga0242825_1003136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ruminococcus → Ruminococcus bromii | 12452 | Open in IMG/M |
| Ga0242825_1009047 | Not Available | 3560 | Open in IMG/M |
| Ga0242825_1020483 | Not Available | 1469 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0242825_1000190 | Ga0242825_10001901 | F056309 | RSTVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKDREAVSPLIN |
| Ga0242825_1001326 | Ga0242825_10013261 | F056309 | GTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0242825_1001691 | Ga0242825_10016911 | F059106 | HAIVWKIRVILLQTFVWIVDLKVREHLTEYLKKDIKYHQVIIEVLV |
| Ga0242825_1001710 | Ga0242825_10017103 | F042936 | VWKTKEGIMKTSGIVDRGEDTIRNCEKVEQEGALTPPYLGKVHFRSRLRGKG |
| Ga0242825_1002112 | Ga0242825_10021121 | F071325 | FHKFQYCSIFKVLLALLSDSSIIISKVVLFVKHFFDIFLSFPNAFSKAFRPHAVRFPAAFLLVHRFYLAFEELLSCATAYL |
| Ga0242825_1003136 | Ga0242825_10031361 | F089005 | LTKSKQRSIIALALLRLATSNEESKQALKVRRTLKIEQRENSKETRNDFEESSKNYSEMYTKKHQEL |
| Ga0242825_1009047 | Ga0242825_10090475 | F078822 | SFPNAFLKAFHPHAVRFPAAFLLVHRFYLAFEELLSCATAYL |
| Ga0242825_1020483 | Ga0242825_10204831 | F076190 | VRTAGGSITISVKNVFTAASRVSGRVWSLVRITVPNDLKFVRIRVEKP |
| Ga0242825_1055550 | Ga0242825_10555501 | F078004 | MSTPFYNNIIFFQITVFYVPAVSRRIRSLALLSAVSEHLSSRNTDFLFRDLLFRKSSTGGLSAVAGSAALDIHMIRHTLVIAVINTFYRLTVDTDGMAWMRQGITERLSSLSLLRKALAAGAVTITGMLTSHHDVSLAAQTVLV |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |