NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029685

3300029685: Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_40m (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300029685 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114292 | Gp0306346 | Ga0265603
Sample NameMetatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_40m (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size79450227
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available5
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei2
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → lake → saline water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationCanada: Sakinaw lake, British Columbia
CoordinatesLat. (o)49.68Long. (o)-124.009Alt. (m)N/ADepth (m)40
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000344Metagenome / Metatranscriptome1257Y
F000388Metagenome / Metatranscriptome1201Y
F004323Metagenome / Metatranscriptome443Y
F025295Metagenome / Metatranscriptome202Y
F098292Metagenome / Metatranscriptome104N
F105212Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0265603_1018205Not Available868Open in IMG/M
Ga0265603_1018556All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia859Open in IMG/M
Ga0265603_1019653All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei832Open in IMG/M
Ga0265603_1019998All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila824Open in IMG/M
Ga0265603_1020505Not Available812Open in IMG/M
Ga0265603_1029462All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei665Open in IMG/M
Ga0265603_1035385Not Available603Open in IMG/M
Ga0265603_1038843Not Available572Open in IMG/M
Ga0265603_1045068Not Available528Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0265603_1018205Ga0265603_10182051F025295DEIMVTGPGEATELLRRREVLIPEKLKFITRKSNLQKQI
Ga0265603_1018556Ga0265603_10185562F004323MPRDGLRRLEGRATPAVAIHSPVTRDYPSRALSDVFQAAALRLFYQGTR
Ga0265603_1019653Ga0265603_10196531F000344MRPRHPHAAESGVGKHTARESESAQACAAGKERVANAHSHKLASE
Ga0265603_1019998Ga0265603_10199981F000344MRPKHPHVAESGVGKHTARESESVKVCAAGKERVVNAHSYKL
Ga0265603_1020505Ga0265603_10205052F000344MRPKHPPAAESGVGKHTARESERAQSCATGKERVANA
Ga0265603_1029462Ga0265603_10294621F004323MPFDGLRRLEGRATPAVATHSPVTRDYPSRALSGVFQAAALRLF
Ga0265603_1035385Ga0265603_10353851F000388KVIKVTKEYFQTEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKNAKD
Ga0265603_1038843Ga0265603_10388432F105212HKGSPKNGGSGQKFLIELEAKSHGSQDPHHRWVGVWDYEEQSEEARITKMC
Ga0265603_1045068Ga0265603_10450681F098292MSDVTRRIDRWQKKYSPAQAKATLDLLQEGMRQRYEAATVEMAAMEMKVKEVLNQQGVHTTNYVPYLSYARQLWKLGRQQHITGESFAMASEVLLQKWAGRGQDPDVLAAIRSQVFNSPPPAP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.