| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029550 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133133 | Gp0283642 | Ga0245019 |
| Sample Name | Human fecal microbial communities from Shanghai, China - P101V1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 88719162 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium UC5.1-2G11 | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Shanghai, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Shanghai | |||||||
| Coordinates | Lat. (o) | 31.2112312 | Long. (o) | 121.4647709 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026489 | Metagenome | 197 | N |
| F047125 | Metagenome / Metatranscriptome | 150 | N |
| F051936 | Metagenome | 143 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0245019_100221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 46557 | Open in IMG/M |
| Ga0245019_104114 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium UC5.1-2G11 | 3156 | Open in IMG/M |
| Ga0245019_123252 | Not Available | 551 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0245019_100221 | Ga0245019_10022110 | F026489 | LTPKENQKSASDFDALEPRKXXXXXXXXXXXPEKTEDSRLFGVKIF |
| Ga0245019_104114 | Ga0245019_1041143 | F051936 | MKQEGTGLCPVLPLALRGKAFGFSVLQEHAVMTLVISIFFAMLIIRHLSIHISIKK |
| Ga0245019_123252 | Ga0245019_1232521 | F047125 | MDVALLLMVLGVMLSGFWAADALDHMRKEIIRQEG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |