| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029532 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133133 | Gp0283525 | Ga0244902 |
| Sample Name | Human fecal microbial communities from Shanghai, China - P022V6 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 129491147 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Shanghai, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Shanghai | |||||||
| Coordinates | Lat. (o) | 31.2112312 | Long. (o) | 121.4647709 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067844 | Metagenome | 125 | N |
| F067845 | Metagenome | 125 | N |
| F076189 | Metagenome | 118 | N |
| F081453 | Metagenome | 114 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0244902_100046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia faecis | 161319 | Open in IMG/M |
| Ga0244902_100377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 54796 | Open in IMG/M |
| Ga0244902_101070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 22433 | Open in IMG/M |
| Ga0244902_104574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3781 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0244902_100046 | Ga0244902_10004683 | F081453 | MSPFFLLAGDNIIEKHISANPVCGTNIRAPELAVKGAPERKCVQ |
| Ga0244902_100377 | Ga0244902_10037719 | F076189 | VLSAGHCFFLSPFIKPLLYVEKLQIGTVLPVVSDLYREFAELSAYFDLYAIQSAQKQLKMLCNFHENTFGLLIFYTNYAIL |
| Ga0244902_101070 | Ga0244902_10107013 | F067845 | MKHWKNLLVCLLAGVLALGVLTACSGLGSVNTGTDAEKAAELAQQLGVAHTQELDNTAKAVAEWFVQEPDSLRVSGLDLVYTVALDADGNMGYTNNLNDFLYWSGCYGVPKDVTVALLLDDSAAAELLDDAAGHNEMGAAFIDYNGTAYVVAVFR |
| Ga0244902_104574 | Ga0244902_1045742 | F067844 | MNTLAAETASAWYLILNRKLQTLPIYKAQPSSPLPRPLTMGKQQVSAGAAVITPQHRSYRVPQGSPQVFGGP |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |