


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029524 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133130 | Gp0283417 | Ga0244794 |
| Sample Name | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005361-17 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 210473706 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Shanghai | |||||||
| Coordinates | Lat. (o) | 31.2123446 | Long. (o) | 121.4684853 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029444 | Metagenome | 188 | Y |
| F051936 | Metagenome | 143 | N |
| F078693 | Metagenome | 116 | N |
| F089053 | Metagenome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0244794_100422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 55196 | Open in IMG/M |
| Ga0244794_108600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3620 | Open in IMG/M |
| Ga0244794_113098 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis | 2421 | Open in IMG/M |
| Ga0244794_114242 | Not Available | 2242 | Open in IMG/M |
| Ga0244794_135930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 881 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0244794_100422 | Ga0244794_10042261 | F078693 | MVLAPVRGAERFFIKANCSLLMSKENQKTTSDFDALDPRERGYSPLSDPEGEVETEKS |
| Ga0244794_108600 | Ga0244794_1086003 | F029444 | MEVSEQLTGFEPKDLMSRTVSNLQRPFREDFSLQKSGIIAEKESQILGCRFVGFDRPKKAAPFFNF |
| Ga0244794_113098 | Ga0244794_1130986 | F051936 | LALRGKAFGFSVLQKHAVMTPVIILFFEMLIIRYLSIHISIKK |
| Ga0244794_114242 | Ga0244794_1142423 | F078693 | MVLALVRGAERSFIQADCSLLMSKENQKTTSDFDALDPRERGCSPLSDPEG |
| Ga0244794_135930 | Ga0244794_1359303 | F089053 | LCRAKRALFQFGSRNGCVVGGCRPVKGCIRKWLYIFANGQLKLSTAEEVNVKNMEAFL |
| ⦗Top⦘ |