


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029206 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127425 | Gp0193121 | Ga0167480 |
| Sample Name | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021280-21 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 143384000 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Beijing, Peking Union Medical College | |||||||
| Coordinates | Lat. (o) | 39.911947 | Long. (o) | 116.4156125 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032286 | Metagenome / Metatranscriptome | 180 | Y |
| F062845 | Metagenome | 130 | N |
| F076189 | Metagenome | 118 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0167480_101171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 19419 | Open in IMG/M |
| Ga0167480_101213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 18662 | Open in IMG/M |
| Ga0167480_104821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 3906 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0167480_101171 | Ga0167480_1011717 | F076189 | MPGRLCYLPGIAFFLFPFIKPLLYVEKLQIGTVLPVVSDLYREFAELSAYFDLCAIQSAQKQLRMLCNFHENTFWLLIFYANYAIL |
| Ga0167480_101213 | Ga0167480_1012132 | F032286 | MVKWVCQIVAPVRHRALVFDTRLSAGNTADDTLVTGGTFRFCRLMCPCVKRRNVKPDSKHRSLPDSALFRADNRTGRKTISPFSLALILTFDFAALSERRSCPEVRSRRFVLLGALDAALRQRTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAPKTQISTLMDRIGQIRNEGRIACG |
| Ga0167480_104821 | Ga0167480_1048212 | F062845 | MKKTPFILHEKFRSDNNEQRKEDFQKEFERYIIDGLLNAVPSRSCA |
| ⦗Top⦘ |