NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029200

3300029200: Biofilm microbial communities from University of Hong Kong - Biofilm



Overview

Basic Information
IMG/M Taxon OID3300029200 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118575 | Gp0137470 | Ga0120082
Sample NameBiofilm microbial communities from University of Hong Kong - Biofilm
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Hong Kong
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size66096889
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia1
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnvironmental Microbial Communities From Various Locations To Study Antibiotic Resistance - The University Of Hong Kong
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Biofilm → Environmental Microbial Communities From Various Locations To Study Antibiotic Resistance - The University Of Hong Kong

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002630Metagenome / Metatranscriptome542Y
F029893Metagenome / Metatranscriptome187Y
F039700Metagenome / Metatranscriptome163Y
F047326Metagenome / Metatranscriptome150Y
F053372Metagenome / Metatranscriptome141Y
F066929Metagenome / Metatranscriptome126N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0120082_1000920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia3730Open in IMG/M
Ga0120082_1002129Not Available2482Open in IMG/M
Ga0120082_1002551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2288Open in IMG/M
Ga0120082_1015705All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium867Open in IMG/M
Ga0120082_1017215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria819Open in IMG/M
Ga0120082_1025658Not Available628Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0120082_1000920Ga0120082_10009204F053372LIIQDRDGSLLKEPKPPRNSALSKPAYRVEIPASTLDEHSSLIERVIAFAFDTLGARHLDVRVREYE
Ga0120082_1002129Ga0120082_10021296F029893MPVMQDSVSVAANSVSANVVAGQLYEFVPTGTKVTLSCTGSATGLRATLIANIPVMNDQAINLQNRFPIIPDDIVFQGAVRACRLVLTARNTTGGALTFFWRIDVN
Ga0120082_1002551Ga0120082_10025511F047326DGRHGFDGALVGAVDVDQLDLCVADIVIDARPVFGDCGRGSVGTANG
Ga0120082_1015705Ga0120082_10157051F002630DAALRLRDVGLNALRADPLMDPIRDEPRFRALLQRLKFPD
Ga0120082_1017215Ga0120082_10172152F066929NSRRSAVELTQTYLENIERALMLNRVQISAKASPAAAGDGAMLDEIEKVSSAPLDYYDANKTSAMTRLLELMIIAERAVSDTSNRDELLKWGPGRLMPILEGPLKDNCVMKR
Ga0120082_1025658Ga0120082_10256582F039700MPLFEVAILEQPTKKEAEEGASEKLVFGPTAVVAPNQQSAAIAAVMDAKAPTNIDRNRMQVLVRPFA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.