| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029183 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127413 | Gp0192418 | Ga0168032 |
| Sample Name | Aquariaum water viral communities from Chicago, USA - Caribbean Reef - CR2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Michigan State University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 37033702 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Aquariaum Water Viral Communities From Chicago, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water → Aquariaum Water Viral Communities From Chicago, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | na → na → na |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Chicago | |||||||
| Coordinates | Lat. (o) | 41.87 | Long. (o) | -87.61 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029294 | Metagenome | 189 | Y |
| F030996 | Metagenome / Metatranscriptome | 183 | Y |
| F046981 | Metagenome / Metatranscriptome | 150 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0168032_100029 | All Organisms → cellular organisms → Bacteria | 30241 | Open in IMG/M |
| Ga0168032_105812 | Not Available | 1174 | Open in IMG/M |
| Ga0168032_118689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 548 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0168032_100029 | Ga0168032_10002910 | F029294 | MKQETGETRNAIIEDDEKVIQQILDANKELRNLYWIVLFAKPAKVNVDGKPTLMKHIKPYFKKPAVQVGMIIGEVNNQKGTISWDVNMPQKPFDFDALKAFGAEEADEAVVETTSIPGAYVTK |
| Ga0168032_105812 | Ga0168032_1058121 | F030996 | MASTNTITGRLGKFVVGSTLVARTTGWAVNPKLASQTEWGDSDSSGYTNRAEGRKDATFTAEGKFDTGAAVWTLFQPGDTAIAVLWMNTTLYWDFPCALCQDFNIQVDIDTEQVQAWTSAWGADGVFYRPGEAGATTRTLPIVTGK |
| Ga0168032_118689 | Ga0168032_1186891 | F046981 | MALGIEQIDDFVASIHQKFAGEDRRAAQDISLPLQNYKYASRLFDNNLTKDTMSTSQCKWKLKVRTNDNFQVVGLYHRDSSNRVNVLDEGELKWGLTTNNYHYDIDEEIFRTGGRQIYDYLEDMERDLMTSFYTGMEDLIFGPGPSSPTATPFPPVIVTGK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |