


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029176 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127425 | Gp0193156 | Ga0167503 |
| Sample Name | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021315-129 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 73852328 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Host-Associated Microbial Communities From Gut And Oral Samples Of Rheumatoid Arthritis Patients In China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal secretion |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Beijing, Peking Union Medical College | |||||||
| Coordinates | Lat. (o) | 39.911947 | Long. (o) | 116.4156125 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062845 | Metagenome | 130 | N |
| F067720 | Metagenome | 125 | Y |
| F067844 | Metagenome | 125 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0167503_100143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 70993 | Open in IMG/M |
| Ga0167503_100198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 58797 | Open in IMG/M |
| Ga0167503_108783 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0167503_100143 | Ga0167503_10014350 | F067720 | MASTTYKHFVDANKMYAAQEQFRDITKMVCARLRGLTKTYHFAVIGTMVRNAGQLPQPFWLGAAYGGGSCSAARCAARA |
| Ga0167503_100198 | Ga0167503_10019831 | F062845 | VTHITTKWTEKGDPMKKTPFILHEKFRSDNNEQRKERFQKEFERYIIDGLLDAVPSRACA |
| Ga0167503_108783 | Ga0167503_1087831 | F067844 | QSHMNTLAAETASAWYLILNRKLQTLPIYITQLSSHLPRPLTMGTQQVSAGAAVITPQHRSYRVPQGSPQVFGGP |
| ⦗Top⦘ |