


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300028490 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046784 | Gp0296289 | Ga0256824 |
| Sample Name | Hydrothermal vent microbial communities from East Pacific Rise, Pacific Ocean - CV67 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 611481128 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Pacific Ocean: East Pacific Rise | |||||||
| Coordinates | Lat. (o) | 9.8597 | Long. (o) | -104.2997 | Alt. (m) | N/A | Depth (m) | 2507 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026277 | Metagenome / Metatranscriptome | 198 | Y |
| F031102 | Metagenome / Metatranscriptome | 183 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0256824_10228558 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 639 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0256824_10228558 | Ga0256824_102285582 | F026277 | ENTKPIWEQLNDTSKKSILSQARLYPEDVLTTEAQVEHFWSTRKLKTNESVTKKLVSHESLIQEDKLSNNEVQAIMERFKNI |
| Ga0256824_10298972 | Ga0256824_102989722 | F031102 | MSEGRYSMKEVLKQKFGEAEKNTKTSMSTKRVKSKSKGKYIVKIVNGVKYMTLR |
| ⦗Top⦘ |