Sample 3300028484

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300028484

3300028484: Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung F36

Overview

Basic Information
IMG/M Taxon OID	3300028484 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0116274 \| Gp0272183 \| Ga0233380
Sample Name	Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung F36
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	235294088
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa
Type	Host-Associated
Taxonomy	Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	USA: California
Coordinates	Lat. (^o)	38.04	Long. (^o)	-122.5	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074001	Metagenome / Metatranscriptome	120	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0233380_1030496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1207	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0233380_1030496	Ga0233380_10304963	F074001	MHKNSPGAQLDQVSAKTDEVQRELEVASAELGLTHGALDRHLPPAQRNDDVAWAIAQNAALERKVAQAAEDLEEVVGMLEQVKAEVGA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.