| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300028389 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133461 | Gp0215325 | Ga0264393 |
| Sample Name | ANME aggregate JGI 7061.QLV.BNCT.01.K10_combo |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 4983159 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Sediment Cell Enrichment Communities From Methane Seep In Santa Monica Basin, California, United States |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Sediment Cell Enrichment Communities From Methane Seep In Santa Monica Basin, California, United States |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: California | |||||||
| Coordinates | Lat. (o) | 33.0 | Long. (o) | -118.0 | Alt. (m) | N/A | Depth (m) | 860 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068505 | Metagenome | 124 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0264393_10122 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 5827 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0264393_10122 | Ga0264393_101223 | F068505 | MKAILKIRNRGKRGYDISSIPMKKLEKMSHYRKKRWIIKKGFLVLEAF |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |