NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028232

3300028232: Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8d (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028232 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0133460 | Gp0294616 | Ga0256327
Sample NameMetatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8d (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size6325280
Sequencing Scaffolds5
Novel Protein Genes6
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota2
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biome → river → river water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: New York
CoordinatesLat. (o)45.0061Long. (o)-74.7949Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007472Metagenome / Metatranscriptome350N
F023532Metagenome / Metatranscriptome209N
F071977Metagenome / Metatranscriptome121Y
F086577Metagenome / Metatranscriptome110Y
F102558Metagenome / Metatranscriptome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256327_101435All Organisms → cellular organisms → Eukaryota800Open in IMG/M
Ga0256327_101594Not Available765Open in IMG/M
Ga0256327_101914All Organisms → cellular organisms → Eukaryota699Open in IMG/M
Ga0256327_102408Not Available621Open in IMG/M
Ga0256327_103491Not Available525Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256327_101435Ga0256327_1014351F007472WYSYKVEFSYTRVSASDSSLASSLYNYTETTFDMYGQTVQTQAANTKIVRTTQNTYAQLGASNVNQQFKIQQAFVLIALLVAGLLFVAHTLYFFDAFRNKILFFVGITALRTLLIIALLVVIASEVIAFLAFLGLSDKIASDNANCLSGPCQKFSDTVTTQLGQQNIAIGTEASVAVTLQYITRWGPTAGWYLVLATIPLTVLATIIVVINRFPIPVDSLGTGEAL
Ga0256327_101594Ga0256327_1015941F086577GSSFARLKTLGATVIATQSWTVIGDVRVVSFAFSVLMETDAAGNRKFSGSVQGSISIGRFTFGAYVPFNKPGSQMEFVLPEVTVNGVNVNELFGVGTTVSVGADDVENLLAGAGAEVTARVKAELAQKAAELKALAKEQLRANLLAPLQELQARAELMRQQAQNGSVLLLGNVVDALRINGFDSKVLNPGVAGLPDFGSFGLTDLVTEMAAPANGSSFARLKTLGATVIATQSWTVIGDVRVVSFAFSVLMETD
Ga0256327_101914Ga0256327_1019141F007472LLATVFAVLIAAMAVDWYSYKVEFSYTRVSASDSSLASSLYNYTQTNFDMFGQTVHVQSANTKIVRTTQQTYAQLGASNVNQQFKIQQAFVLIALLTAGLLFVAHTLYFFDGFRNKILFFVGITALRTILIIALLIVVASEIIAFLAFLGLSDKIASDSPNCLSGPCQKFSDSVTTQLGQSTLVIGTEASVAVALQQIASWGPTAGWYLVLATIPLTVLATIIVVINRFPIPV
Ga0256327_102408Ga0256327_1024081F071977GIADIGSKAINAVSTGINQAGQAIKSTVSGAVDAIGNVHKTVAGGLDKALGTDMFSKASNAVHDFVGGGIKNAVNQVVDFGSGAMVGALKHVNDRITDFFDPNKSKREYMNSQEYKDKMAAKAIFQTFSTKLGLPSNMPKYLTDSLVQWIIGEMKVTPLRRQPFLTNLNSDDQCVSEKAPDTCNEDDIKCIVLANKCFLDDEGCVR
Ga0256327_103328Ga0256327_1033281F102558ACVARAVQEAAVFSQLRPKLLKPFQGADKMYEVVLVLKRLYEGQGSRSQAVEAVTSSGLEGLEQRTLVAAALLLFEDGAGIAAGMSDRREGSHGSAAVGSAIVSEDDLQCCQNALSIFGDQSIEEVFTDDAEDFTVNVACVARAVQEAAVFSQLRPKLLKPFQGADKMYEVVLVLKRLY
Ga0256327_103491Ga0256327_1034911F023532VTVIVPEMEPLPALVHVAVGLLAVKEVKPDTVITAADVADAPVNPRVMVEAVETTLFANETEAEDKAPANIAGTATPLKVSRGAKPLPAPKVDIVEVVAAAAALGVVRPERTHTTAAFKARAVPRSILKLGVEYVTVIVPEMEPLPALVHVAVGLLAVKEVKPDTVITAADVADA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.