| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300028029 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046784 | Gp0296315 | Ga0256845 |
| Sample Name | Tube worm associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - Riftia |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 592228120 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Annelida → Integument → Unclassified → Unclassified → Tube Worm Surface → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Pacific Ocean: East Pacific Rise | |||||||
| Coordinates | Lat. (o) | 9.8441 | Long. (o) | -104.2967 | Alt. (m) | N/A | Depth (m) | 2503 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023595 | Metagenome / Metatranscriptome | 209 | Y |
| F031503 | Metagenome / Metatranscriptome | 182 | Y |
| F036294 | Metagenome / Metatranscriptome | 170 | Y |
| F088496 | Metagenome / Metatranscriptome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0256845_1022635 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2846 | Open in IMG/M |
| Ga0256845_1078041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1201 | Open in IMG/M |
| Ga0256845_1089464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1096 | Open in IMG/M |
| Ga0256845_1116291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 920 | Open in IMG/M |
| Ga0256845_1169239 | Not Available | 719 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0256845_1022635 | Ga0256845_10226355 | F088496 | MGHIKKFNERYKSDELDLQKDQHLMSIRQNGERIGDIEIVDGEITTSGFIGDNQYDNFVELIKGLQGFDIEIDDFFW |
| Ga0256845_1078041 | Ga0256845_10780411 | F023595 | MVDFGSGQGLSDFETAGIASYFEDFKRAKTQPWAERCRLWMGTNYGAI |
| Ga0256845_1089464 | Ga0256845_10894642 | F023595 | MVDFGSGQGLSDFETAGIAGYFEDFKRAKTQPWAERCRLWMGNN |
| Ga0256845_1116291 | Ga0256845_11162912 | F036294 | MGRGSSEEAIVGVKLVADEDAVTYPRVKLPESDKDVGAEGWNM |
| Ga0256845_1169239 | Ga0256845_11692391 | F031503 | MDLNEMRELFKETANIHTPEGLAAYRAFAAALTTPILQKIELESIMRSLFTVEKLAPGAQAVYPVAEDFEIPVWVLPGLSYVAQNFIEGIGEEVFVPTFTIDASADWKINYARDSRIDIAQRAAANAAKRLAAYEEECG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |