NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027532

3300027532: Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by proteinase K digestion (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027532 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0099546 | Gp0055082 | Ga0209544
Sample NameHost-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by proteinase K digestion (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size458766452
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHost-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea
TypeHost-Associated
TaxonomyHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationGulf of Piran, Adriatic Sea
CoordinatesLat. (o)45.5099Long. (o)13.56Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002359Metagenome / Metatranscriptome567Y
F050452Metagenome / Metatranscriptome145Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209544_1072174All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1140Open in IMG/M
Ga0209544_1149683All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209544_1072174Ga0209544_10721742F002359MIEYDIADMMDGVKNMIEASDIRAGDQVLLLADRRSDTASVEAITAGLKFMGAEPMSLVTEPISRYGRVPQAVLQAMEASDVVIWMWPVFITFTPAHRAMGRKREESGTQLKEQRMKPYFIYFEGTPGLLARDYARFPNPVLWKLAEKVREVVAAGKVVRIEDDLGSHLTATYDGTRLYGMQFQAGDPPGRCHFPWGRCGVFNGSGKADGEVYLSCVQGVAGALPAPMKWVVKDSEVVEAEGGELAEECRQLFKNVPGS
Ga0209544_1149683Ga0209544_11496831F050452DRLIVHEQGMLDRSLLHHPEVLEAASAYGDPYQVLAPVSHDAHGSGTLW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.