NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027469

3300027469: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK07-E (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027469 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0091532 | Ga0207628
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK07-E (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size19944295
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group1
All Organisms → cellular organisms → Bacteria1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004903Metagenome / Metatranscriptome419Y
F015672Metagenome / Metatranscriptome253Y
F026365Metagenome / Metatranscriptome198Y
F029788Metagenome / Metatranscriptome187N
F048215Metagenome148Y
F063979Metagenome129Y
F077690Metagenome / Metatranscriptome117Y
F083305Metagenome / Metatranscriptome113Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207628_100137All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1012Open in IMG/M
Ga0207628_100452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium771Open in IMG/M
Ga0207628_100555All Organisms → cellular organisms → Bacteria → Proteobacteria742Open in IMG/M
Ga0207628_100898All Organisms → cellular organisms → Bacteria → Terrabacteria group666Open in IMG/M
Ga0207628_101279All Organisms → cellular organisms → Bacteria613Open in IMG/M
Ga0207628_101290Not Available612Open in IMG/M
Ga0207628_101388All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
Ga0207628_102171All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207628_100137Ga0207628_1001372F004903MSRYLQKISLRPYSETEIWTGWELEGRDGEIEGLVLADAMSDEEIAALGVTEFQKIPKEYLADILPKR
Ga0207628_100452Ga0207628_1004523F077690RLTELNADPASPLAEIAAEVRRVEALSRELQESRRLIDGLERRTRELRTAWLKHHADAGSPFDRR
Ga0207628_100555Ga0207628_1005553F029788DDDGGVRAVMTGRHLHNLCALLGQDLDVERARDEYLASLDADDGLAVLLIPRDEILAAATARPPVARCDRCGARLSRKRRHRCSRCGLRQT
Ga0207628_100898Ga0207628_1008981F026365RLIVSLYVFALTLALPVAAYAAASDNEGKPTGHDWTITTIFFIALSIPALLGLLTLIDIARGKHTQRHD
Ga0207628_101279Ga0207628_1012792F083305VVAMVRHLDDAQREEFHRAFVELYEGYRTEDGGIRAPRRYLLVLGRRK
Ga0207628_101290Ga0207628_1012902F015672MDELQEKHVEIDERWLTEWFEFGFAEMSSYLAKHAAFDDFCDQHELD
Ga0207628_101388Ga0207628_1013881F063979MNYDLAMMALEGLTRAPLTVRVDGGRVTISGEAASFKELARLCLLLGGAGGAEESFELQPAVHVGKGSPGLKLELA
Ga0207628_102171Ga0207628_1021711F048215VHAYVAPLTNAVESEIVAPAQYGPPFDAVGVAGMALTTTSVVPAAEGHPSTVMVTEYVPASAVVAFVRVGFCCVEVKPFGPVHEYVAPLTNVVESEIVAPSQYGPPLLAVGVAGVALTTTLVVPAAEVQPLTVMVTEYVPASAVVAFERVGFCCVEVKPFGPVHAYVAPLTNAVESEIV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.