


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026915 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053063 | Gp0055414 | Ga0208838 |
| Sample Name | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN106 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 10928158 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | forest biome → land → fertilized soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Browns Valley, California, USA | |||||||
| Coordinates | Lat. (o) | 39.23550963 | Long. (o) | -121.2836963 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036627 | Metagenome | 169 | Y |
| F041998 | Metagenome / Metatranscriptome | 159 | Y |
| F059436 | Metagenome / Metatranscriptome | 134 | N |
| F081180 | Metagenome / Metatranscriptome | 114 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0208838_100146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
| Ga0208838_100276 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| Ga0208838_100362 | Not Available | 728 | Open in IMG/M |
| Ga0208838_100463 | Not Available | 671 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0208838_100146 | Ga0208838_1001461 | F081180 | MNRAETEDGSYASARNRKLLAEWAAKAGENEYAEPALNPCQTTAYA |
| Ga0208838_100276 | Ga0208838_1002762 | F041998 | MGDKQHVLELLDKGLPPLWVGPAEQLLGFLPRQREAVQGRADRLAAAPQPEALAHPADQAAQRPAWRWLRPNYGRRRGRALGGADHLAEFGCAVWAKKGRRPPVRRNASASGP |
| Ga0208838_100362 | Ga0208838_1003622 | F059436 | MNRSAEDGEWSSPHSGGEGTGVPPRRTKVCAGDTVGKSVSDPGRPGIVHREGMAGIVRHSQTKGRETGNAKPGLKPPMVGADISASEIPTEAVPGVGSGRGTQERGQSKRPRIAAGRAATPVGPKRSTGGGRPRAVWQRRRATSG |
| Ga0208838_100463 | Ga0208838_1004632 | F036627 | MKVKRGTEIIETSNQNIQMQVIESIKINPNSLKLDHRKLR |
| ⦗Top⦘ |