NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026748

3300026748: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05K1-12 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026748 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0091545 | Ga0207575
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05K1-12 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21265268
Sequencing Scaffolds8
Novel Protein Genes9
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
Not Available1
All Organisms → cellular organisms → Archaea2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 38431
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001436Metagenome / Metatranscriptome695Y
F003059Metagenome / Metatranscriptome510Y
F012397Metagenome281Y
F019338Metagenome / Metatranscriptome230Y
F039759Metagenome163Y
F042319Metagenome / Metatranscriptome158Y
F064047Metagenome / Metatranscriptome129Y
F067149Metagenome / Metatranscriptome126N
F098876Metagenome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207575_100118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1344Open in IMG/M
Ga0207575_100704All Organisms → cellular organisms → Bacteria857Open in IMG/M
Ga0207575_100800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria831Open in IMG/M
Ga0207575_100860Not Available814Open in IMG/M
Ga0207575_101492All Organisms → cellular organisms → Archaea705Open in IMG/M
Ga0207575_101881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843658Open in IMG/M
Ga0207575_102272All Organisms → cellular organisms → Archaea620Open in IMG/M
Ga0207575_102330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium616Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207575_100118Ga0207575_1001181F067149MRKTIILAAATLLLACVTVVTGVARTIEGPSANLASLVVSPHTIGGLTAR
Ga0207575_100118Ga0207575_1001183F042319MTDITYQTATAGIACPSALLSRIAAWCTHFAEGIREGREIAARYHALSRLSTPELARRGLNRQTIARAALTSY
Ga0207575_100704Ga0207575_1007041F001436CDRHHIWSRTDSPTVRWGMKRDKDIVALIELLKLAAEQWPHANCEISQTDLFHRNQSLLEMWPEACRRAGVGGRDFPSGVIKLWKQGAGRVN
Ga0207575_100800Ga0207575_1008002F019338GFDADRQWRPIFRLGVLGSMPAMRRTEAVLTAGAVACLAFVSIVYPVFAQDVDPRCKDIFDKVACTCAVRNGGHVIPPPVGVKREGLKLRPKEEAGGTQTLDGGRVAFPKYYRREGLKFHRSRALEGYLACMRAAGRK
Ga0207575_100860Ga0207575_1008601F039759FLPGHRSQDVTLWEGAVFALSSLLFVAASMAPFYGIRRVQNAFQSTFATQVQQVCPAQPPEAMIACWAQFYPWSRVAIDLGAPIVIAVICLVLANRLRHFGRQHFINRLAELKVLPAASTLFLRAFRDDQVRIRRASRNLFSSVFDLGRVPATLDELMLERLDGRGDLIAIGNPQDRKGAARQSPWGAQRLYVDDAHWQETVTMLARDADRIVLCIDASDGVRWEIAHVLQSGHAGKTLFFLNPSTDVQTRKRQLQEDFGVSAADLASIDV
Ga0207575_101492Ga0207575_1014921F012397VRWNRILILIVLVTTLSLLSGPSFSFSEIKIEINVTPPLNWEPSPTNNSTTMIWFQNSTKSIFAIIRAPDDLVFPLFIAGPFMTGYLKYKGVLESADRLTFGHSNYGYRYFLNLSSPSKLLDSSSGLIPKNEFLSKIPEGYDVPFKGMLILTQKHNE
Ga0207575_101881Ga0207575_1018812F064047MTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQ
Ga0207575_102272Ga0207575_1022721F098876VNIQSQIVAGKNPSIEFSLHLKLTHESRYPNIKFSSSGEKISVQEDRLMTKDEVSQDMIPEYYDNELITEEFVKERLIRLIKSCFDKDWQSFYS
Ga0207575_102330Ga0207575_1023301F003059MVRAGIAAGMLAGAAIVMAAMPAAAQVRDAVYRGTLICDKLPFSAGKGREAIEVTIAGGTVRYSHVVRLRDAAEPVSEQGKGSLNGQDIELQGSWKSGNRQYEAKYSGAFVRRHADLKGTQTWTDGGKSFTRACTGTIKRPFRVFLPGEKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.