| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026710 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053056 | Gp0054273 | Ga0207846 |
| Sample Name | Marine sediment microbial community from La Parguera, Puerto Rico - PR Tt Sediment 3 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 22979519 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 2 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → intertidal zone → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Bioluminescent Bay, La Paraguera, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 17.96725 | Long. (o) | -67.0188733 | Alt. (m) | N/A | Depth (m) | .4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042645 | Metagenome / Metatranscriptome | 158 | Y |
| F042907 | Metagenome / Metatranscriptome | 157 | Y |
| F047064 | Metagenome / Metatranscriptome | 150 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0207846_102728 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| Ga0207846_102730 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| Ga0207846_109472 | Not Available | 623 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0207846_102728 | Ga0207846_1027282 | F042645 | MPRLSDLDIYEIRQFFEEALNQARCTNKRDKMRMRRKIRDEVFNLLTWEKPTPTSIMNRWEERLHDIFSVMPYGFKDDLFHILSDKMLSPLQQEQS |
| Ga0207846_102730 | Ga0207846_1027303 | F047064 | METIEIKARRSWDRQVLEYFEDLDIICNDYNRTILRYLGKLNRLLHEERIDQSEYDALNRDLLKVSEALNQVPRTIKDIK |
| Ga0207846_109472 | Ga0207846_1094721 | F042907 | MMTDEMLAEAEEKLFNDLRDEPCIVCGDPYMYVLGSYTPEQPSGAPKREDKAAVLYYTLCQKCFNNGRIPTARIEAVYRSKFGKIAA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |