NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026663

3300026663: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK07-B (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026663 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0072129 | Ga0207532
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK07-B (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size7042990
Sequencing Scaffolds6
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.43Long. (o)-89.41Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003564Metagenome / Metatranscriptome479Y
F003779Metagenome / Metatranscriptome469Y
F030422Metagenome / Metatranscriptome185Y
F053646Metagenome / Metatranscriptome141Y
F057613Metagenome136Y
F059931Metagenome / Metatranscriptome133Y
F095664Metagenome / Metatranscriptome105N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207532_100194Not Available794Open in IMG/M
Ga0207532_100340Not Available688Open in IMG/M
Ga0207532_100469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium642Open in IMG/M
Ga0207532_100742All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia577Open in IMG/M
Ga0207532_100905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia552Open in IMG/M
Ga0207532_101270All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium503Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207532_100058Ga0207532_1000581F095664MPFDRRHVLAQWGGTLPGGEIWSNSLRLASTDTGPDADVPDHDAMVEWLTTYAKDAVAAWHGSFDLKCSNQAKLAYLKMNVVDIAGRYIEQNTLEYLYSPVVPGGSASNIHPTQIALAVSLTTEFSRGHAHRGRFYVPMPVHVVDATTGLISVSDAIQVATAAKTFIEALADEPGPDILPGMRVCVMSQRGTGATNVVTGVDVGRVL
Ga0207532_100194Ga0207532_1001942F059931MGDLLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQ
Ga0207532_100340Ga0207532_1003403F003564REDGEELHAEVRCWDKAHAAAERGANADALAAIADRGSAIALEYAEQVESPAKRGAVLISIWFDAADNGNLRRRVSYERAPA
Ga0207532_100469Ga0207532_1004692F030422VTVSVLSDKSAASYVLSLLPTFGAASALTPEEERRLGAVVESLVRFTLDNAYPNDELGEIEVTLEADEGFVRVVVHDWGLPLTSAGADFGPLPEPLAALASEARSLQLVNL
Ga0207532_100742Ga0207532_1007421F057613MLVPSHDSKATALGIGDSSQVGFLWPGAQRKTDNQSKATYVNHLIGMALGAVDIANGEVYFRSNHGFKSLPSVVSAASGGGRTLNLRSAGLYTYLFATYDGYGSEVWY
Ga0207532_100905Ga0207532_1009051F053646MTKRLILPALLLAALALAATAAAGSGQGKGKGKGHGQHGKFGPYDVVTDDHGSCSNAWAVDTEKRTFKVRRNNDGSY
Ga0207532_101270Ga0207532_1012701F003779MKMTLKNRTALVALLFGLALSLVPKVNASGPFATNYTNASLTGVYGYSSDGWHLGSSNPSKNTTNIPLDAAGVMWFDGLSTFKFHDTADLGGFVIQRGTADNPIVGTYTVNPDGTGTMQWFSDGSNHARAFAIVDGGRELQFGAADGLDVARG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.