


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026519 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046784 | Gp0296304 | Ga0256839 |
| Sample Name | Hydrothermal vent microbial communities from Mid Atlantic Ridge, Atlantic Ocean - 354-166 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 577576218 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → rock |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Atlantic Ocean: Mid Atlantic Ridge | |||||||
| Coordinates | Lat. (o) | 36.2297 | Long. (o) | -33.9011 | Alt. (m) | N/A | Depth (m) | 2262 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071990 | Metagenome / Metatranscriptome | 121 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0256839_1114428 | Not Available | 901 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0256839_1114428 | Ga0256839_11144282 | F071990 | MAVPTTRFRVIPNSTATTAVDTPAKRLGIISGESLVSTGAGNEADLGTVNISAGAANSAVIHMLWDVTADGGNTLVDTFKLWLSANGFDVAASVLRFAAISGADQTIPTNTQNYVANATTASYTFADMPETEPASQNVYPSDEGTSMALATTSDDAIMWAV |
| ⦗Top⦘ |