NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026391

3300026391: Metatranscriptome of enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.4 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300026391 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0132855 | Gp0267202 | Ga0232080
Sample NameMetatranscriptome of enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.4 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size79464087
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin0384
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1
All Organisms → cellular organisms → Bacteria1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa
TypeEngineered
TaxonomyEngineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUSA: New York
CoordinatesLat. (o)42.4447Long. (o)-76.485Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021795Metagenome / Metatranscriptome217Y
F028541Metagenome / Metatranscriptome191Y
F031111Metagenome / Metatranscriptome183N
F034230Metagenome / Metatranscriptome175Y
F049732Metagenome / Metatranscriptome146Y
F055836Metagenome / Metatranscriptome138Y
F056712Metagenome / Metatranscriptome137N
F103516Metagenome / Metatranscriptome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0232080_103999All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes3208Open in IMG/M
Ga0232080_115612All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin0381064Open in IMG/M
Ga0232080_118120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038933Open in IMG/M
Ga0232080_120212All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria847Open in IMG/M
Ga0232080_123152All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038753Open in IMG/M
Ga0232080_123564All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038741Open in IMG/M
Ga0232080_124727All Organisms → cellular organisms → Bacteria712Open in IMG/M
Ga0232080_136196Not Available517Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0232080_103999Ga0232080_1039991F031111KTRRKKEKSRFLIGKKRCISNIPQNSYYQTIVNIPAAYNFCCYYPQNLPSSQIGKQVKKILKPLNLALIKLSKPKLTFP
Ga0232080_115612Ga0232080_1156121F055836MESCEGEVVAIYRKKWSRQFLGFVAVTLRWPMLLLLTLGRFLKINCIFTVYPGSQRDVDGYFPKGLKWFLKPAASGKPFVAGVITTGNGLGRGLVLAVPNTVDQFKKDRDLVGTIMKNLKLTRTLTGAKTIAVAGQGPRFFKSHFPYEQPFVYGLKGRVFSVVETVEQVAATNGLTRSETTVAILGVGEIGAAIIANLKEKGYRAVGIDIRIAEGRVEIGREGMETLRKADLIVVQTPRGDDVVPYYENLKKTAILIDDAHPRITVRPGEVKFYKVAIGRSGVEFKPPLPGYEKYWIPGCVQESMVVAESGKVDMSQEDFNKRSKEL
Ga0232080_118120Ga0232080_1181202F028541TMDEKERLKLVNRLKTVKTSEERDQILWYLAGQDKAARGKAQRAEPTGTGKPAPGKTEEKPRVSLPVGKLGGVGSFTALLFLFYGLVSIVTAVMKILQGQMEGDEIKQLIMGGLFLLFGVVIYVRARRAQRKTAEET
Ga0232080_120212Ga0232080_1202121F049732MDVFRILFNILLFTASLFAAALFVEKIYAGRWKWAAFPVLLAFILAFALVPGTLIGVLEALPGELSPANAATLALGGTAAGF
Ga0232080_123152Ga0232080_1231522F021795ERKKAEGKSSFTVVLSHQAREILAEEKEKTGESYAVIMEKALLGLKKQGYTPPILRHFPRREEVLARVAAQDSPPAPASNAGRVNHEGDRQPRILIDDLANYPTLEDIEREQAAKELNGVHVLRSSEGLITRLLRSSAGPFGRKKKWFK
Ga0232080_123564Ga0232080_1235641F034230MLSGFVLFGAAAPARSAEAGPETNKLKVKVGPFFIQESDKKISLEGAAPYVIRKGKRVNITVTVENYGKEKSEPVRLRYVETDGKAGEPRLYRVEAIEPGKKWQRTFMARWDTSGRKSVTAALVTLEDKPLRDAKGKPRPDTAHTGSIVLTAKQM
Ga0232080_124727Ga0232080_1247272F056712GANSKIPAAGLVGLLEGIEKSLVRRLMKSSGKQPFLIVLLIIFLSMNKKGKKKSEPERDENYWRVIGGL
Ga0232080_136196Ga0232080_1361961F103516LLAGCGAATNVQVMKPVNGEIQSFLTPELLKSRCYNFMSAGREGEMIAKKSNVLLNECNLTAKDAVNRVTYLTYTTKDAYVAESGENQVISKRVMGNKDIEIESSLFYEKEGGVRGIQVLINDFVDKNYVKGYEPEWVVRALYREVKLQDGKIVVVRDGMTRDEFMKEDEIE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.