


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300025193 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0054073 | Ga0208061 |
| Sample Name | Marine microbial communities from the Deep Atlantic Ocean - MP0555 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 56088055 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -26.91 | Long. (o) | -21.43 | Alt. (m) | N/A | Depth (m) | 3199.21 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063069 | Metagenome | 130 | Y |
| F066126 | Metagenome | 127 | Y |
| F089570 | Metagenome | 109 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0208061_101733 | Not Available | 2913 | Open in IMG/M |
| Ga0208061_107432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1207 | Open in IMG/M |
| Ga0208061_121021 | Not Available | 620 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0208061_101733 | Ga0208061_1017331 | F066126 | RHFPKSRANCGGKNSVGKAIRNTATIPAYKKRLNNNDLKSNI |
| Ga0208061_107432 | Ga0208061_1074321 | F089570 | FKFLFFFFCILFLNTKIPLSESERPSLDFNEKQKTIVSNALSNCGDYNFDDLLNTRKKELGISEPDKSINKKKQLDNSLGIEVSRSIETIYTPEQSLANVKKILSSINDDRLYPAVAYYIIKDFAFYEHGLCKSLRNHFQTYNIYKEFYFKTKNKELDPIYENENNLNFFYKNTSNARKRLLLAIQSKKRLLEKEQFLLKNLKIFTETYI |
| Ga0208061_121021 | Ga0208061_1210212 | F063069 | PWEIFNSSLILELNSPIKKLCPTHEKKVKIKPKIIILKLDLTISIIMFNYEL |
| ⦗Top⦘ |